KEGG   Drosophila simulans: Dsimw501_GD15919Help
Entry
Dsimw501_GD15919  CDS       T01065                                 

Gene name
Dsim_GD15919
Definition
(RefSeq) GD15919 gene product from transcript GD15919-RA
  KO
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dsi  Drosophila simulans
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dsimw501_GD15919 (Dsim_GD15919)
Enzymes [BR:dsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Dsimw501_GD15919 (Dsim_GD15919)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Dsimw501_GD15919 (Dsim_GD15919)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 428 aa AA seqDB search
MSTTTTSIEGYKLGKVIIEGKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLAGKAEI
SNTTNGQVFRLLNEAGIRTAYVKQCGAKAFIARKCQMIPIEWVTRRLATGSFLKRNVGVP
EGYRFSPPKQETFFKDDANHDPQWSEEQIISAKFELNGLVIGQDEVDIMRRTTLLVFEIL
ERAWQTKNCALIDMKVEFGICADGNIVLADIIDSDSWRLWPAGDKRLMVDKQVYRNLAAV
TASDLDTVKRNFIWVAEQLADIVPKKDHLVVVLMGSASDISHSEKIATSCRSLGLNVELR
VSSAHKGPEETLRIVREYESVMSNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNM
QVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMVWSKLRVKALNNFITLKKADK
ELRGVRNA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacaaccacatccattgagggctacaagctcggcaaggtcatcatcgagggc
aagaccaagcaggtgtacgatctgccggagcagccaggattgtgcctgctcctcagcaag
gatcgcatcaccgccggcgatggtgtcaaagctcacgatctggccggcaaggcggagatc
tccaataccaccaacggccaggtcttcaggctgctcaacgaggcaggcattcgcaccgcc
tatgtgaaacagtgcggcgccaaggccttcatcgcccgcaaatgccagatgatacccatt
gagtgggtgacccgtcgcctggccaccggttcgtttctcaagcgcaatgtcggagtgccc
gagggctacaggttctcgccgcccaagcaggagacgttcttcaaggacgatgccaaccac
gatccccagtggagcgaggagcagattatctccgccaaattcgagctgaatggcctggtg
atcggccaagatgaggtggacattatgcgtagaaccacactgctggtcttcgagattctc
gagagggcgtggcagaccaagaactgcgccctgatcgacatgaaagtggagttcggtatc
tgcgccgatggcaacattgtgctggccgacatcattgattccgattcgtggcgtttgtgg
ccagcgggtgacaagcgtttgatggtcgacaagcaggtgtatcggaatctggcagcggtg
actgccagcgatttggatacggtgaagaggaacttcatttgggtggccgaacaactggct
gatattgtgcccaagaaggatcatctggttgtcgttctgatgggcagtgcctccgatata
tcgcacagcgagaagatagccaccagctgtcgatcccttggcctcaatgtggaactccgc
gtgagttccgcccacaagggaccggaggaaacgctgcgcattgtccgcgaatacgaatcg
gtgatgagcaacctgatctttgtggccgtcgccgggcgatccaatggactgggtccagtc
gtttccggcagcaccaactatccggtgatcaattgtccgcccgtcaaatcggacaacatg
caggtggacgtgtggtccagcttgaatctgccatcgggcctgggctgtgccacagtcctg
tatccagaggcagctgctctgcatgcggccaccattctggggctgggcaacttcatggtc
tggtcgaaattgcgtgtcaaggcgctcaacaactttatcactctcaagaaggccgacaag
gagttgcgcggcgtgcgaaatgcttag

DBGET integrated database retrieval system