KEGG   Drosophila simulans: Dsimw501_GD15945Help
Entry
Dsimw501_GD15945  CDS       T01065                                 

Gene name
Dsim_GD15945
Definition
(RefSeq) GD15945 gene product from transcript GD15945-RB
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsimw501_GD15945 (Dsim_GD15945)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsimw501_GD15945 (Dsim_GD15945)
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsimw501_GD15945 (Dsim_GD15945)
Ubiquitin system [BR:dsi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dsimw501_GD15945 (Dsim_GD15945)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 1129 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEILTSDLQQTQQQRNSPPQLPKFKNLIQPQLHAVGAVTQL
PSENGNMPPQQLLADSSSTSFGDGEAMGIDDESKEDQFRSETTFSFTVENVVQLKSQRLS
PPVFVRMLPWRIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHKPDAQPFTRAR
IKHLFYSKENDYGYSNFITWQELKDSEKSYVHNNSITLEVHVVADAPHGVLWDSKKHTGY
VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSAKSVGLSLQRVFHELQFGDRP
VGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIK
CKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGV
IFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEQINLDRYLAESENTLADYVLHAVL
VHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEISFHAKCSNA
YMLVYIRQSELDRVLGDITESEISSDLVERLDLEKRIEMARRKERGEANTYVSVHVILEE
NFEEQHKRRLFDLEKVHPRVFRIKQNQTVDELVDMFVRGFGVSRQRMRMWNLCTAQTQKF
LHFDFVAEGSRTIEQISTSQKPWVIWLQLAWTDVPGPLPSFNPKTEALLFIKYYDPRNKR
LNYIGCTQQPHTRRLIDLVPDVNSKLGFDPDTELTIYDEYADKKLVNLNEPIESALFIPQ
DHLQGHILIFERENVDAKLDLPTVGDYFLDLVYRIEIIFSDKCNPNEPDFTLELSNRYNY
DQLANAVAERLNTDPQKLQFFMCINNYKETAGNAVPYTFKGTIKDLVSYTKQSSTKRIFY
QRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKISFAENSRR
KLRLMKISNHKIVAICKDDIPLDTLLKSNESITTTQGAQKTFRIEEVPAEEMQLAENEFL
IPVAHFSKELYNSFGIPFLTKARQGEPYGAVKQRIQRRLNVQDKEWENYKFCVISMGHNA
DVNDNTPVDLEVYRSWTSGQLPFFGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagaaacagatcagtctattgaagcaatggacacccaggacacccaagaggtc
gagatcctcaccagtgaccttcaacagacacaacagcagcggaattcaccgccccaattg
ccgaaattcaagaatcttatccagccacaattgcacgccgttggtgcagtgacccaattg
cccagcgagaacggcaatatgccgccacaacaactattggcagatagtagctccacttcg
ttcggcgacggcgaggccatgggcattgacgatgagtccaaggaggatcagttccgatcg
gagaccacattctcctttaccgtcgagaatgtggtacaattgaaatcgcagagactgtcg
ccgccagtgtttgtccgcatgctgccatggaggataatggtcatacccaatgatcgtgcg
ctcggcttctttctgcagtgcaatggggagaatgattcgcccacctggtcgtgcaatgcc
attgccgagctgcgtttgaagtgccacaagccggatgcacagccctttacgcgtgcccgc
attaagcatttgttctactccaaggagaatgactatggctactcgaatttcatcacctgg
caggagctgaaggattccgaaaagagctatgtgcacaacaacagcatcaccctggaggtt
cacgtcgttgcggatgcaccgcatggcgttctgtgggactccaagaagcacacaggctat
gttggccttaaaaaccaaggcgccacttgctatatgaactcgctgctgcagacattgtac
ttcaccaattcgctaagactgtctgtttatcgcatacccacggaggctgacgatagtgcc
aaatcagttggattatcgctgcagcgtgtgttccatgaactgcagttcggtgaccgtccc
gttggcaccaagaagctaaccaagtcctttggctgggaaacgctcgattcgttcatgcag
cacgatgtccaggagtttctgcgcgtgctgctcgacaagctcgagtcgaagatgaagggc
accatcctggagggcaccataccgggtctgttcgagggcaaaatgtcgtcgtacatcaag
tgcaagaatgtcgactacaacagcacacgttacgagacgttctacgacatccagctgaac
atcaaggataagaagaatatctacgagtctttccaggattacgtagctcccgaaacgctg
gagggtgacaacaaatacgatgctggtgtgcacggcttgcaggaagccagcaagggcgtc
atcttcacttcattcccacccgttttgcatctgcacctgatgcgcttccagtacgatccc
gtcacggacagctcgatcaagtacaacgatcgcttcgagttctacgaacagatcaatctg
gatcgctacctggccgagagcgagaataccttggcggactacgttctgcacgccgtgctg
gtgcactcgggcgataaccatggcgggcactatgtggtcttcattaatccaaaggctgac
ggacgttggtttaagttcgacgacgatgtggtctccagttgccgcaagcaggaggcaatc
gaacagaactacggcggcatggacgacgagatctcgttccacgccaagtgcagcaatgcc
tatatgctggtctacatccgccagtcggagttggatcgcgtactcggcgacataacggag
agcgagatatcaagcgatctggtggagcgtctcgatctggagaagcgcatcgaaatggcg
cgccgcaaggagcgcggcgaggccaacacctatgtgtccgtgcacgtgatcctcgaggag
aacttcgaggagcagcacaagcgtcgtctcttcgatctggagaaggtccatccgcgcgtc
ttccgcatcaaacaaaatcagactgtcgacgagctggtggacatgttcgtgaggggtttc
ggtgtgtcgcgccaacgcatgcgcatgtggaacttgtgcaccgcccagacgcaaaagttc
ttgcatttcgatttcgtggcggagggatcgcgcaccatcgagcagatatcaacgtcacag
aaaccgtgggtcatctggctgcagctggcctggacggatgtacctggtcccctgccgtcc
tttaatcccaagaccgaagccctgctgttcatcaagtactacgatccgcgcaacaagcgt
ctcaattacattggatgtacccagcagccgcacacccgccgtctcattgatctggtgccg
gatgtgaatagcaaattgggtttcgatccggacaccgagctgaccatctacgatgagtac
gccgacaagaagctggtcaatctgaacgagccgatcgagagtgcgctgttcataccgcag
gatcatctgcaaggtcacatcctaatcttcgagcgcgaaaacgttgacgccaaactcgac
ctgcccacggttggggattacttcctggatctggtctatcgcatcgagatcatcttcagc
gacaaatgcaatcccaatgagccggactttacgctggagctgtccaatcgctataactac
gatcagctggccaatgcggtggccgagcgcttgaacaccgatccacagaagctgcagttc
ttcatgtgcatcaacaactacaaggagacggcgggcaatgccgtgccctacacatttaag
ggcacaatcaaggatctggtttcttacaccaaacagagctcaacgaagcgtatcttctat
cagcggctgtcgctcagcattcacgagctggacaacaagaagcagttcaagtgcgtctgg
gtgagcagcgacctcaaggacgagaaggagctggtcctgtaccccaacaagaacgatacg
gttaagggactgctggaggaggcggccaagaaaatctcgtttgcggagaacagccgtcgc
aagttgcgcctgatgaagattagcaatcataagattgtggcgatatgcaaggacgatata
ccgctggatacgctgctaaagtccaacgagtccataacgaccacacagggcgctcaaaag
acttttcgcatcgaggaggtgccggcggaggaaatgcaattggcggagaacgagttcctc
atcccagtggcccatttcagcaaggagctgtacaactcattcggcatacccttcctaacc
aaggcgcgccagggcgagccgtacggtgcggtcaagcagcgcatccagcgtcgtctgaat
gtgcaggacaaggagtgggaaaactacaaattctgtgtgatctccatgggccacaatgcg
gatgtgaacgacaatacgcccgttgacctggaggtgtatcgctcgtggaccagcggccag
ttgcccttctttggcttggatcacatcaataagtcgcgcaagcgcagctcgcttaacttc
tccgagaaggccatcaaaatatacaactaa

DBGET integrated database retrieval system