KEGG   Drosophila simulans: Dsim_GD15945Help
Entry
Dsim_GD15945      CDS       T01065                                 

Definition
GD15945 gene product from transcript GD15945-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dsi04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1129 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEILTSDLQQTQQQRNSPPQLPKFKNLIQPQLHAVGAVTQL
PSENGNMPPQQLLADSSSTSFGDGEAMGIDDESKEDQFRSETTFSFTVENVVQLKSQRLS
PPVFVRMLPWRIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHKPDAQPFTRAR
IKHLFYSKENDYGYSNFITWQELKDSEKSYVHNNSITLEVHVVADAPHGVLWDSKKHTGY
VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSAKSVGLSLQRVFHELQFGDRP
VGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIK
CKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGV
IFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEQINLDRYLAESENTLADYVLHAVL
VHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEISFHAKCSNA
YMLVYIRQSELDRVLGDITESEISSDLVERLDLEKRIEMARRKERGEANTYVSVHVILEE
NFEEQHKRRLFDLEKVHPRVFRIKQNQTVDELVDMFVRGFGVSRQRMRMWNLCTAQTQKF
LHFDFVAEGSRTIEQISTSQKPWVIWLQLAWTDVPGPLPSFNPKTEALLFIKYYDPRNKR
LNYIGCTQQPHTRRLIDLVPDVNSKLGFDPDTELTIYDEYADKKLVNLNEPIESALFIPQ
DHLQGHILIFERENVDAKLDLPTVGDYFLDLVYRIEIIFSDKCNPNEPDFTLELSNRYNY
DQLANAVAERLNTDPQKLQFFMCINNYKETAGNAVPYTFKGTIKDLVSYTKQSSTKRIFY
QRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKISFAENSRR
KLRLMKISNHKIVAICKDDIPLDTLLKSNESITTTQGAQKTFRIEEVPAEEMQLAENEFL
IPVAHFSKELYNSFGIPFLTKARQGEPYGAVKQRIQRRLNVQDKEWENYKFCVISMGHNA
DVNDNTPVDLEVYRSWTSGQLPFFGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagaaacagatcagtctattgaagcaatggacacccaggacacccaagaggtc
gagatcctcaccagtgaccttcaacagacacaacagcagcggaattcaccgccccaattg
ccgaaattcaagaatcttatccagccacaattgcacgccgttggtgcagtgacccaattg
cccagcgagaacggcaatatgccgccacaacaactattggcagatagtagctccacttcg
ttcggcgacggcgaggccatgggcattgacgatgagtccaaggaggatcagttccgatcg
gagaccacattctcctttaccgtcgagaatgtggtacaattgaaatcgcagagactgtcg
ccgccagtgtttgtccgcatgctgccatggaggataatggtcatacccaatgatcgtgcg
ctcggcttctttctgcagtgcaatggggagaatgattcgcccacctggtcgtgcaatgcc
attgccgagctgcgtttgaagtgccacaagccggatgcacagccctttacgcgtgcccgc
attaagcatttgttctactccaaggagaatgactatggctactcgaatttcatcacctgg
caggagctgaaggattccgaaaagagctatgtgcacaacaacagcatcaccctggaggtt
cacgtcgttgcggatgcaccgcatggcgttctgtgggactccaagaagcacacaggctat
gttggccttaaaaaccaaggcgccacttgctatatgaactcgctgctgcagacattgtac
ttcaccaattcgctaagactgtctgtttatcgcatacccacggaggctgacgatagtgcc
aaatcagttggattatcgctgcagcgtgtgttccatgaactgcagttcggtgaccgtccc
gttggcaccaagaagctaaccaagtcctttggctgggaaacgctcgattcgttcatgcag
cacgatgtccaggagtttctgcgcgtgctgctcgacaagctcgagtcgaagatgaagggc
accatcctggagggcaccataccgggtctgttcgagggcaaaatgtcgtcgtacatcaag
tgcaagaatgtcgactacaacagcacacgttacgagacgttctacgacatccagctgaac
atcaaggataagaagaatatctacgagtctttccaggattacgtagctcccgaaacgctg
gagggtgacaacaaatacgatgctggtgtgcacggcttgcaggaagccagcaagggcgtc
atcttcacttcattcccacccgttttgcatctgcacctgatgcgcttccagtacgatccc
gtcacggacagctcgatcaagtacaacgatcgcttcgagttctacgaacagatcaatctg
gatcgctacctggccgagagcgagaataccttggcggactacgttctgcacgccgtgctg
gtgcactcgggcgataaccatggcgggcactatgtggtcttcattaatccaaaggctgac
ggacgttggtttaagttcgacgacgatgtggtctccagttgccgcaagcaggaggcaatc
gaacagaactacggcggcatggacgacgagatctcgttccacgccaagtgcagcaatgcc
tatatgctggtctacatccgccagtcggagttggatcgcgtgctcggcgacataacggag
agcgagatatcaagcgatctggtggagcgtctcgatctggagaagcgcatcgaaatggcg
cgccgcaaggagcgcggcgaggccaacacctatgtgtccgtgcacgtgatcctcgaggag
aacttcgaggagcagcacaagcgtcgtctcttcgatctggagaaggtccatccgcgcgtc
ttccgcatcaaacaaaatcagactgtcgacgagctggtggacatgttcgtgaggggtttc
ggtgtgtcgcgccaacgcatgcgcatgtggaacttgtgcaccgcccagacgcaaaagttc
ttgcatttcgatttcgtggcggagggatcgcgcaccatcgagcagatatcaacgtcacag
aaaccgtgggtcatctggctgcagctggcctggacggatgtacctggtcccctgccgtcc
tttaatcccaagaccgaagccctgctgttcatcaagtactacgatccgcgcaacaagcgt
ctcaattacattggatgtacccagcagccgcacacccgccgtctcattgatctggtgccg
gatgtgaatagcaaattgggtttcgatccggacaccgagctgaccatctacgatgagtac
gccgacaagaagctggtcaatctgaacgagccgatcgagagtgcgctgttcataccgcag
gatcatctgcaaggtcacatcctaatcttcgagcgcgaaaacgttgacgccaaactcgac
ctgcccacggttggggattacttcctggatctggtctatcgcatcgagatcatcttcagc
gacaaatgcaatcccaatgagccggactttacgctggagctgtccaatcgctataactac
gatcagctggccaatgcggtggccgagcgcttgaacaccgatccacagaagctgcagttc
ttcatgtgcatcaacaactacaaggagacggcgggcaatgccgtgccctacacatttaag
ggcacaatcaaggatctggtttcttacaccaaacagagctcaacgaagcgtatcttctat
cagcggctgtcgctcagcattcacgagctggacaacaagaagcagttcaagtgcgtctgg
gtgagcagcgacctcaaggacgagaaggagctggtcctgtaccccaacaagaacgatacg
gttaagggactgctggaggaggcggccaagaaaatctcgtttgcggagaacagccgtcgc
aagttgcgcctgatgaagattagcaatcataagattgtggcgatatgcaaggacgatata
ccgctggatacgctgctaaagtccaacgagtccataacgaccacacagggcgctcaaaag
acttttcgcatcgaggaggtgccggcggaggaaatgcaattggcggagaacgagttcctc
atcccagtggcccatttcagcaaggagctgtacaactcattcggcatacccttcctaacc
aaggcgcgccagggcgagccgtacggtgcggtcaagcagcgcatccagcgtcgtctgaat
gtgcaggacaaggagtgggaaaactacaaattctgtgtgatctccatgggccacaatgcg
gatgtgaacgacaatacgcccgttgacctggaggtgtatcgctcgtggaccagcggccag
ttgcccttctttggcttggatcacatcaataagtcgcgcaagcgcagctcgcttaacttc
tccgagaaggccatcaaaatatacaactaa

DBGET integrated database retrieval system