KEGG   Drosophila simulans: Dsim_GD16048Help
Entry
Dsim_GD16048      CDS       T01065                                 

Definition
GD16048 gene product from transcript GD16048-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dsi  Drosophila simulans
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dsim_GD16048
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dsim_GD16048
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dsim_GD16048
  Exosomal proteins of breast milk
   Dsim_GD16048
Heparan sulfate/heparin binding proteins [BR:dsi00536]
 Enzymes (General comment) Variety
  Dsim_GD16048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 406 aa AA seqDB search
MPGHVNHLLLLGCLLCLLGDVPRTEAFHRWSPMMKAFRYLQETMLRNSLERAHLNHGIVF
ECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTL
FDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRRNVTLAGYS
LGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSL
GTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFV
GYECGSYREFAAGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPYVPRRQANWLSGVGRM
SSSKVSQVGQSPLVLRLWTNSWRRRERARKRQRRDRDRERSLCANK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtcacgtgaaccaccttctgctccttggctgcctgctctgcctgctcggcgat
gtgccgaggaccgaggctttccaccgctggagtcccatgatgaaggccttccgctatctc
caggagaccatgctccggaatagcctggaacgtgcccatctcaatcatggcatcgtcttc
gagtgtcgcaccatatcagctaaggattttggcaacgaagtgcatttcaatctgcagctt
ggagacctgcgagggtttcgtcgcctcgatcccaacaaaaagttggccctatttttgcac
ggctggaatgatcagggcagcaaggattgggtgcaagaattactgctaacttggacccta
ttcgactccaattacaatgtgtgcgttgtggactggggaaacctgtcgcagaacgactac
aagtccgcctccatgtccattttcgatgtgggcttaacggtggctggaatcatcatggcc
ctggaggagctgcgtcccaatcactttcatcggcgcaacgtgaccttggcgggctacagc
ttgggtgcccatgccgctggatacgcgggcgcggtgctggagggtcaggtggagcagatc
attggcttggatcccgctggaccgctgttctcgctgcccgccgaggtggcgcccaagtac
cgcttggatccaggagatgcgcagttcgtccaggtacttcacacttccggcggctccttg
ggcaccagtctgaagtgcggccacgccgatttctatcccaacggaggcagggcgcctcaa
acgaactgcaagatgttcgccaatctgcgcgacatgcaaaataccaatcccgtttcctgc
agtcactcggcggctgcgatcttcttccggcaatcgatggatcccgagtacccgttcgtg
ggctacgagtgcggcagctaccgggagttcgccgccggatattgcgatggcaaccggaag
gcgcgcttcgggatccattcgcagaggcgtgcgcaggggagcttctacttccgcaccgcg
ccccagcagccgtacgtgccgaggcgacaggccaactggctgagcggggtggggcgcatg
tcgtcgagcaaggtcagtcaggtcggccaaagccccctggtgctgcgcctctggacgaac
agctggcggcggcgggagcgagcgagaaagcgacagcgaagagacagagacagagaaaga
tcgctgtgcgcgaataagtag

DBGET integrated database retrieval system