KEGG   Drosophila simulans: Dsimw501_GD16048Help
Entry
Dsimw501_GD16048  CDS       T01065                                 

Gene name
Dsim_GD16048
Definition
(RefSeq) GD16048 gene product from transcript GD16048-RA (EC:3.1.1.- 3.1.1.1)
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dsi  Drosophila simulans
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dsimw501_GD16048 (Dsim_GD16048)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dsimw501_GD16048 (Dsim_GD16048)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dsimw501_GD16048 (Dsim_GD16048)
  Exosomal proteins of breast milk
   Dsimw501_GD16048 (Dsim_GD16048)
Glycosaminoglycan binding proteins [BR:dsi00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   Dsimw501_GD16048 (Dsim_GD16048)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dsi00537]
 Enzymes
  Dsimw501_GD16048 (Dsim_GD16048)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 406 aa AA seqDB search
MPGHVNHLLLLGCLLCLLGDVPRIEAFHRWSPMMKAFRYLQETMLRNSLERAHLNHGIVF
ECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTL
FDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRRNVTLAGYS
LGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSL
GTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFV
GYECDSYREFAAGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPYVPRRQANWLSGVGRM
SSSKVSQVGQSPLVLRLWTNSWRRRERARKRQRRDRDRERSLCANK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtcacgtgaaccaccttctgctccttggctgcctgctctgcctgctcggcgat
gtgccgaggatcgaggctttccaccgctggagtcccatgatgaaggccttccgctatctc
caggagaccatgctccggaatagcctggaacgtgcccatctcaatcatggcatcgtcttc
gagtgtcgcaccatatcagctaaggattttggcaacgaagtgcatttcaatctgcagctt
ggagaccttcgaggatttcgtcgcctcgatcctaacaaaaagttggccctatttttgcac
ggctggaatgatcagggcagcaaggattgggtgcaagaattactgctaacttggacccta
ttcgattccaattacaatgtgtgcgttgtggactggggaaacctgtcgcagaacgactac
aagtccgcctccatgtccattttcgatgtgggcttaacggtggctggaatcatcatggcc
ctggaggagctgcgtcccaatcactttcatcggcgcaacgtgaccttggcgggctacagc
ttgggtgcccatgccgctggatacgcgggcgcggtgctggagggtcaggtggagcagatc
attggcttggatcccgctggaccgctgttctcgctgcccgcggaggtggcgcccaagtac
cgcttggatccaggagatgcgcagttcgtccaggtacttcacacttccggcggctccttg
ggcaccagtctgaagtgcggccacgccgacttctatcccaacggaggcagggcgcctcaa
acgaactgcaagatgttcgccaatctgcgcgacatgcaaaataccaatcccgtttcctgc
agtcactcggcggctgcgatcttcttccggcaatcgatggatcccgagtacccgttcgtg
ggctacgagtgcgacagctaccgggagttcgccgccggatattgcgatggcaaccggaag
gcgcgcttcgggatccattcgcagaggcgtgcgcaggggagcttctacttccgcaccgcg
ccccagcagccgtacgtgccgaggcgacaggccaactggctgagcggggtggggcgcatg
tcgtcgagcaaggtcagtcaggtcggccaaagccccctggtgctgcgcctctggacgaac
agctggcggcggcgggagcgagcgagaaagcgacagcgaagagacagagacagagaaaga
tcgctgtgcgcgaataagtag

DBGET integrated database retrieval system