KEGG   Drosophila simulans: Dsim_GD16050Help
Entry
Dsim_GD16050      CDS       T01065                                 

Definition
GD16050 gene product from transcript GD16050-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dsi04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:dsi04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:dsi04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:dsi04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dsi04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 2427 aa AA seqDB search
MMADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSNSGWSDQLTGGAGGGNGGGGASGV
TTNPTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVGVGGVVGVGVVPSQMNGAGGGNGSG
TGGDDGSGNGSGAGNRISMNTIAQGNLGNMVLTNSVGGGMGGMVNHLKQQPGGGGGGMIN
AVSVPGGPGAGAGGVGAGGGGAVTANQGMHMQNGPMMGRMVGQQHMLRGPHLMGASGGAG
GPGNGPGGGGPRMQNPNMQMTQLNSLPYGVGQYGGPGGGNNPQQQQQQQQQQLLAQQMAQ
RGGVVPGMPQGNRPVGTVVPMSTLGGDGSGPTGQLVSGNPQQQQMLAQQQTGAMGPRPPQ
PNQLLGHPGQQQQQQQPGTSQQQQQQQGVGIGGAGVVANAGTVAGVPAVAGGGAGGAVQS
SGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVCNVNYCKAMKSVLAHMG
TCKQSKDCTMQHCASSRQILLHYKTCTKHLEALNAGAGAPGAGGSASNVTVSAPSPSPGF
LSNGPSIGTPSNNNNSSSANNNPPSVSSLMQQPLSNRPGTPPYIPASPVPATSASGLAAS
STPASAAATCASSGSGSNSSSGATAAGASSTSSSSSAGSGTPLSSVSTPTSATMATSSGG
GGNAGGGSSTTPASNPLLLMSGGTAGGGTGATTTTSTSSSSRMMSSSSSLSSQMAALEAA
ARDNDDETPSPSGENTNGSGGSGNAGGMASKGKLDSIKQDDDIKKEFMDDSCGGNNDSSQ
MDCSTGGGKGKNVNNDGTSMIKMEIKTEEGLDGEVKIKTEAMDVDEAGGSTAGEHHGEGG
GGSGVGGGKDNINGAHDSGATGGAVDIKPKTDTKPLVPEPLAPNAGDKKKKCQFNPEELR
TALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPW
EYVDDVWLMFDNAWLYNRKTSRVYRYCTKAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQ
LCTIPRDAKYYSYQNSLKEYGVASNRYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQF
KEMKNDHLELEPFVDCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAK
RLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNE
FPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTA
VYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWATSAHV
LEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQKKAKKSNKSKAAQ
RKNSKKSNEHQSGNDLSAKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLM
DGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTAVETRYHCT
VCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQSVQRCIQSLVHA
CQCRDANCRLPSCQKMKRVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEPKCPVPF
CPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTSTAPAALQGPAAVSGPTVVSGGVPVVG
MSGVTVSQPVIPGQAGILPPGAGGMSPSTVAVPSPVSGGAGVGGMGGMTSPHPHQPGIGM
KPGGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPPVMNRPMGGAGPNQNVNQ
LGGMGVGVGGVGGVGVGGVGGVGVNQLNSGGGNTPGAPISGPGMNVNHLMSMDQWGGGGA
GGGGANPGGGNPQARYANNTGGMRQPTQVMQTNLIPPQQQQQMMGGLGGPNQLGGGQMPV
GGQHGGMGMGMGAPPMAGTVGGVRPSPGAGGGGGSATGGGLNTQQLAQIMQKIKNNPTNE
SNQHILAILKQNPQIMAAIIKQRQQSQINAGGGAPGPGGALQQQQAGNGPQNPQQQQQQQ
QQQQQQQVMQQQQMQHMMNQQQGAGGPQQMNPNQQQQQQQVNLMQQQQQGGPGGPGSGLP
TRMPNMPNALGMLQSLPPNMSPGVSTQGGMVPNQNWNKMRYMQMSQYPPPYPQRQRGPHM
GGAGPGPGQQQFPGGGGGAGNFNAGGAGGAGGVVGVGGVPGGAGTVPGGDQYSMANAAAA
SNMLQQQQGQVGVGVGVGVKPGPGQQQQQMGVGMPPGMQQQQQQQQPLQQQMMQVAMPNA
NAQNPSAVVGGPNAQVMGPPTPHSLQQQLMQSARSSPPIRSPQPTPSPRSAPSPRAAPSA
SPRAQPSPHHVMSSHSPAPQGPPHDGMHNHGMHHQSPLPGVPQDVGVGVGVGVGVGVNVN
VGNVGVGNAGGALPDASDQLTKFVERL
NT seq 7284 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgccccaaaagcgggttaaaatggatccaacggac
atctcttactttctggaggagaacctgcccgatgagctggtgtcctcgaacagtggttgg
tcggatcagctgaccggcggagcaggcggtggcaatggaggtggcggcgcctccggtgta
accacaaaccccacatccggcccaaatcccggtggaggacccaacaagccggcagcccaa
ggacccggctctggcacaggcggagtcggtgttggagtcaatgtgggtgtcggcggtgtt
gttggcgtcggcgttgtgccttcccagatgaacggagccggcggcggcaacggatccgga
acgggtggcgacgacggcagtggcaacggctcaggagcgggcaacagaatcagcatgaac
accattgcgcagggcaatctgggaaacatggtgctgaccaacagcgttggcggcggcatg
ggcggcatggttaatcatcttaagcagcagcctggcggcggcggcggtggaatgatcaat
gccgtttcagtacccggaggtcctggagcaggagctggaggcgttggagctggcggcgga
ggagccgttaccgcaaaccaaggcatgcatatgcagaacggcccaatgatgggacgcatg
gtggggcaacagcatatgcttcgtggcccgcatctcatgggtgcctctggaggagctggt
gggccaggaaacgggcctggtggcggaggaccacgcatgcagaatccgaacatgcaaatg
actcaactcaacagtctgccctacggagtgggtcagtatggtggtccaggcggtggcaac
aatcctcagcaacagcagcagcaacagcagcaacaacttctcgcccagcagatggcccaa
agaggcggcgtcgtaccgggcatgccgcagggtaatcggcccgttggcacagtggtgccc
atgtccacactcggcggcgatggatcagggcccacggggcagctggtaagcgggaatcct
cagcagcaacagatgctggcgcagcagcaaaccggagccatgggcccgcgtcctccgcaa
ccaaaccagttgctcggtcatcccggccagcagcagcagcaacagcagcctggcacctcg
cagcagcagcaacagcagcagggagtcggaatcggaggagcaggcgttgtggccaatgca
ggaaccgttgctggcgtgccggcagtggcaggcggcggagccggtggcgccgtgcaatct
agcggccctggtggcgccaatcgcgatgtgcccgacgaccgtaagcgacagatccagcag
caactgatgctgctcctccatgcacacaaatgcaatcgcagggagaacctgaatccgaac
agggaagtgtgcaacgtcaactactgcaaggcgatgaaatccgtgctggcccacatgggc
acttgcaaacagagcaaggactgcaccatgcagcattgtgcctcctcgcgccaaatccta
ttgcattacaaaacgtgcacaaaacatctggaagccctgaatgcgggggctggagcgccg
ggagctggaggatccgcctccaatgtgacggtttcagctccgagcccatcacctggcttc
ctgtccaacggcccgtcgattggcacgccctccaacaataataatagtagtagtgctaac
aacaacccgccctcggtgagcagcctaatgcaacagccgctgagcaatcggccgggtacg
cctccttacatacccgcctccccagtgccggcgacaagtgcgtccggattagcggctagc
agtacgcccgcatcagcagcagccacctgtgcgagtagtggcagtggcagcaatagcagc
agtggagcaactgcagcgggtgcaagttccacgtcatcatcttcctcggcgggctcgggt
acaccactcagctcggtatcgactcctacatcggccacgatggccaccagcagcggtggt
ggtggcaatgcaggaggcggatcatccactacgcccgctagcaatccactgctcctcatg
tctggaggaacggcaggaggcggaacgggagcgacgaccaccacatcgacatcctcgagc
agtcgcatgatgagcagctccagcagtctctcctctcagatggctgccctggaggctgcg
gcgcgagacaacgatgatgagacgccctcgccatccggcgagaatacaaacggcagtggt
ggcagtggaaatgccggcggtatggcctctaagggcaaactggactccattaagcaagat
gacgatatcaagaaggagtttatggatgacagctgtggcggaaataacgatagctcgcag
atggattgctcgacgggtggtggcaagggcaagaatgtgaacaacgacggaaccagcatg
atcaaaatggagatcaagacggaggagggactcgatggcgaggtgaagatcaaaacggaa
gccatggatgtggacgaggctggaggatcgacagccggagagcatcatggcgaaggtggc
ggcggcagtggtgttggcggcggcaaggacaacatcaatggtgcgcacgatagcggagcg
acaggcggtgctgtggacataaaacccaagacggatacgaaaccactcgtaccggagcca
ctggcaccgaatgcgggtgacaagaaaaagaagtgccaattcaatcccgaggaactgcgc
accgctctcctgcctacgctagagaagctctacaggcaggagcccgaatccgtgcccttt
cgctacccagttgatccccaggcgctgggcattcccgattactttgagatcgttaagaag
cccatggacctgggcaccatacgcaccaacatccagaatggaaagtacagtgatccctgg
gagtatgtggacgacgtttggctgatgttcgacaatgcctggctgtataatcgcaaaaca
tcgcgggtctatcgctattgcacaaaggcggagattgatcctgtgatgcaggcactggga
tattgctgcggcaggaagtacacatttaatccacaggtgctctgctgctacggcaagcag
ctctgcacgattccgcgggatgccaagtactacagctaccagaacagtctaaaggaatac
ggtgtcgcctcaaatagatacacctactgccaaaagtgctttaacgacatccagggcgat
acggtcacactgggcgacgatccactgcaatcgcaaacccaaatcaaaaaggatcagttc
aaggagatgaagaacgatcatctcgaactggagccgtttgtcgattgccaggagtgcgga
cgcaaacagcaccagatctgcgtgctctggctggattcaatttggcccggtggcttcgtg
tgcgataactgcctgaaaaagaagaactcaaagcggaaggagaacaagttcaatgcgaaa
cgcctgcccaccaccaagctgggcgtgtacatagagacgcgggtgaataatttcctcaag
aagaaggaggctggtgccggcgaggtgcacattcgtgtggtcagctcatcggacaagtgt
gtagaggtgaagcccggcatgcgtcgacgattcgtcgagcagggcgagatgatgaacgag
ttcccatatcgcgccaaagccctctttgccttcgaggaggtggacggcatcgatgtgtgc
ttctttggcatgcacgttcaggagtatggatccgagtgcccggcgccgaatacgcggcgt
gtttacattgcctatttggattccgttcatttcttccggccaagacagtaccgtacagcg
gtatatcacgaaattctgctcggctacatggactacgtgaaacagctgggctacacaatg
gcccatatctgggcctgtccgccatccgagggggatgactacatcttccactgccatccc
acggaccagaagatacccaagcccaagcgcctgcaggagtgggcgacttctgcccatgtg
ctggaggagagcatcaaggaactggaccaggaggaggaggagaagcgcaagcaggccgag
gccgcggaagcagcagctgcggcaaatcttttctcaatcgaggagaacgaagtcagcggc
gatggcaaaaagaagggccagaagaaggccaaaaagtcgaacaaatcgaaagcggcgcag
cgtaagaacagcaaaaagtccaacgaacatcagtcgggcaacgatctctccgccaagata
tatgcgaccatggagaagcacaaggaggtcttcttcgtcatccgtctgcattcggcgcag
tcggcagctagtttagcgcccatccaggatcccgatccgctgctcacatgcgatctgatg
gatggacgcgatgccttcctcaccctcgcccgcgacaagcactttgagttctcgtcgctg
cggcgcgcacagttctccactctgtccatgttgtatgagctgcataaccagggtcaggac
aagttcgtttacacctgcaaccactgcaagacggccgtggagacgcgctaccactgtact
gtttgtgatgacttcgatctgtgtatcgtgtgcaaggagaaggttggccatcagcacaag
atggagaagctcggcttcgacatcgacgacggctctgcgctggcggatcacaagcaggct
aatccgcaggaggcccgcaagcaatccgtccagcgttgcatccaatcgctggtgcacgcc
tgccagtgtcgcgatgccaactgccgcctgccatcgtgccagaagatgaagcgcgtcgtc
cagcacacgaagaactgcaaacgcaagcccaacggaggatgccccatctgcaagcagctt
atcgcactctgttgctaccacgccaagaactgtgaggagccgaagtgccccgtgccgttc
tgtcccaacatcaagcacaagctcaagcagcagcagtcccagcagaaattccagcagcag
cagttgctgcgtcgccgtgtggcgctcatgtcgcgtacatctacagctccagcggctctg
caaggcccagctgcagtaagcggtccgaccgtcgtctctggaggagtgcccgtggtgggc
atgtccggtgtgacagttagccaaccggttatccccggccaggcgggtatactacctcca
ggggcgggtggcatgtcgccatctacagtggcagttccatcgcctgtttcaggaggagcg
ggagtcggtggaatgggtggaatgacatcaccacatccgcatcaaccaggcataggtatg
aaaccaggtggcggtcactcgccgtcgccaaatgtcctacaagtggtgaagcaggtccag
gaagaggcagctcgtcagcaggtttcgcatggcggtggcttcggcaagggcgtacccatg
gcgccgcccgtaatgaatcgtccaatgggcggcgcaggacccaaccaaaatgttaatcaa
cttggtggcatgggcgttggagttggaggtgtcggtggtgttggcgtcggaggcgttggt
ggagtgggtgttaatcaactgaattcgggtggtggcaatacaccgggtgcccccatttcc
ggtcccggaatgaatgtgaatcatctgatgtccatggatcagtggggcggtggcggagcc
ggcggcggaggtgccaatcccggcggaggcaacccacaagcccgctatgccaacaatacc
ggcggcatgcgccagcccacacaggtgatgcaaacgaatctgataccgccgcagcaacag
caacagatgatgggcggactgggcggacccaaccaactgggaggtggtcaaatgccagtc
ggcggacagcacggaggaatgggaatgggcatgggagccccgccaatggccggaactgtt
ggcggggtgcgtccatctcccggagcaggaggtggaggtggaagtgcaactgggggcggt
ctaaatacccaacaactcgcccagattatgcagaagattaagaacaatcccaccaacgag
agcaaccagcacatccttgccatactgaaacagaatccgcagatcatggcggcgatcatc
aagcagcgccagcagtcgcagatcaatgcgggcggaggagctcctggccccggtggagcc
ttacagcagcagcaggctggtaacggaccgcaaaatcctcaacagcagcagcagcagcaa
caacagcagcagcagcaacaggtgatgcagcaacagcagatgcagcacatgatgaaccag
cagcagggcgccggcggtccccagcagatgaatcccaaccagcagcagcaacagcagcag
gttaatctcatgcagcaacagcaacaaggtggacccggaggaccaggttctggacttccc
acgcgcatgcccaacatgcccaatgccttgggcatgctgcaaagtcttccgcccaacatg
tcgccaggcgtttccactcagggaggaatggtgcccaaccaaaactggaacaagatgcgt
tacatgcaaatgagccagtacccgccaccgtatccgcagcgccagcgtggtccgcacatg
ggcggagcgggacctggccccggccagcaacagttccccggtggcggaggtggagcgggc
aacttcaatgcaggtggtgctggtggtgcaggcggcgttgtcggtgtgggcggagtgccc
ggaggagccggcacggtgcccggcggcgatcagtactcgatggcgaatgcggccgctgcc
tccaatatgctgcaacagcagcagggccaggtgggcgtcggagtgggtgtgggcgtgaaa
ccaggacccggccaacagcaacagcagatgggcgttggcatgccgccgggtatgcagcag
caacagcagcaacagcaaccgctgcagcagcagatgatgcaggtggcgatgccaaatgcg
aatgcccagaatccgtcggcggtggtgggcggacccaatgctcaggtgatgggtccgccg
acgccgcactctctgcagcagcagctgatgcaatcggcccgctcatcgccgcccattcgc
tccccgcagccaacgccatcgccacgttcggctccatcgccacgtgctgctccctccgcc
tcgcctagggcacagccctcgccgcatcatgtgatgagcagtcactcgccggcgccgcag
ggaccaccgcatgacggcatgcacaatcatggcatgcatcatcagtcgccactgccagga
gtgccgcaggatgttggcgtcggagtcggtgtcggtgtcggtgttggcgttaacgttaac
gtcggcaacgtgggtgtcggcaatgccggaggagccctgcccgacgcctccgaccagctg
accaagtttgtggagcgactctag

DBGET integrated database retrieval system