KEGG   Drosophila simulans: Dsim_GD16050Help
Entry
Dsim_GD16050      CDS       T01065                                 

Definition
GD16050 gene product from transcript GD16050-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsim_GD16050
   04330 Notch signaling pathway
    Dsim_GD16050
   04350 TGF-beta signaling pathway
    Dsim_GD16050
   04630 Jak-STAT signaling pathway
    Dsim_GD16050
   04068 FoxO signaling pathway
    Dsim_GD16050
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsim_GD16050
Transcription factors [BR:dsi03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dsim_GD16050
Mitochondrial biogenesis [BR:dsi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dsim_GD16050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 2427 aa AA seqDB search
MMADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSNSGWSDQLTGGAGGGNGGGGASGV
TTNPTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVGVGGVVGVGVVPSQMNGAGGGNGSG
TGGDDGSGNGSGAGNRISMNTIAQGNLGNMVLTNSVGGGMGGMVNHLKQQPGGGGGGMIN
AVSVPGGPGAGAGGVGAGGGGAVTANQGMHMQNGPMMGRMVGQQHMLRGPHLMGASGGAG
GPGNGPGGGGPRMQNPNMQMTQLNSLPYGVGQYGGPGGGNNPQQQQQQQQQQLLAQQMAQ
RGGVVPGMPQGNRPVGTVVPMSTLGGDGSGPTGQLVSGNPQQQQMLAQQQTGAMGPRPPQ
PNQLLGHPGQQQQQQQPGTSQQQQQQQGVGIGGAGVVANAGTVAGVPAVAGGGAGGAVQS
SGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVCNVNYCKAMKSVLAHMG
TCKQSKDCTMQHCASSRQILLHYKTCTKHLEALNAGAGAPGAGGSASNVTVSAPSPSPGF
LSNGPSIGTPSNNNNSSSANNNPPSVSSLMQQPLSNRPGTPPYIPASPVPATSASGLAAS
STPASAAATCASSGSGSNSSSGATAAGASSTSSSSSAGSGTPLSSVSTPTSATMATSSGG
GGNAGGGSSTTPASNPLLLMSGGTAGGGTGATTTTSTSSSSRMMSSSSSLSSQMAALEAA
ARDNDDETPSPSGENTNGSGGSGNAGGMASKGKLDSIKQDDDIKKEFMDDSCGGNNDSSQ
MDCSTGGGKGKNVNNDGTSMIKMEIKTEEGLDGEVKIKTEAMDVDEAGGSTAGEHHGEGG
GGSGVGGGKDNINGAHDSGATGGAVDIKPKTDTKPLVPEPLAPNAGDKKKKCQFNPEELR
TALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPW
EYVDDVWLMFDNAWLYNRKTSRVYRYCTKAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQ
LCTIPRDAKYYSYQNSLKEYGVASNRYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQF
KEMKNDHLELEPFVDCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAK
RLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNE
FPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTA
VYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWATSAHV
LEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQKKAKKSNKSKAAQ
RKNSKKSNEHQSGNDLSAKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLM
DGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTAVETRYHCT
VCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQSVQRCIQSLVHA
CQCRDANCRLPSCQKMKRVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEPKCPVPF
CPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTSTAPAALQGPAAVSGPTVVSGGVPVVG
MSGVTVSQPVIPGQAGILPPGAGGMSPSTVAVPSPVSGGAGVGGMGGMTSPHPHQPGIGM
KPGGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPPVMNRPMGGAGPNQNVNQ
LGGMGVGVGGVGGVGVGGVGGVGVNQLNSGGGNTPGAPISGPGMNVNHLMSMDQWGGGGA
GGGGANPGGGNPQARYANNTGGMRQPTQVMQTNLIPPQQQQQMMGGLGGPNQLGGGQMPV
GGQHGGMGMGMGAPPMAGTVGGVRPSPGAGGGGGSATGGGLNTQQLAQIMQKIKNNPTNE
SNQHILAILKQNPQIMAAIIKQRQQSQINAGGGAPGPGGALQQQQAGNGPQNPQQQQQQQ
QQQQQQQVMQQQQMQHMMNQQQGAGGPQQMNPNQQQQQQQVNLMQQQQQGGPGGPGSGLP
TRMPNMPNALGMLQSLPPNMSPGVSTQGGMVPNQNWNKMRYMQMSQYPPPYPQRQRGPHM
GGAGPGPGQQQFPGGGGGAGNFNAGGAGGAGGVVGVGGVPGGAGTVPGGDQYSMANAAAA
SNMLQQQQGQVGVGVGVGVKPGPGQQQQQMGVGMPPGMQQQQQQQQPLQQQMMQVAMPNA
NAQNPSAVVGGPNAQVMGPPTPHSLQQQLMQSARSSPPIRSPQPTPSPRSAPSPRAAPSA
SPRAQPSPHHVMSSHSPAPQGPPHDGMHNHGMHHQSPLPGVPQDVGVGVGVGVGVGVNVN
VGNVGVGNAGGALPDASDQLTKFVERL
NT seq 7284 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgccccaaaagcgggttaaaatggatccaacggac
atctcttactttctggaggagaacctgcccgatgagctggtgtcctcgaacagtggttgg
tcggatcagctgaccggcggagcaggcggtggcaatggaggtggcggcgcctccggtgta
accacaaaccccacatccggcccaaatcccggtggaggacccaacaagccggcagcccaa
ggacccggctctggcacaggcggagtcggtgttggagtcaatgtgggtgtcggcggtgtt
gttggcgtcggcgttgtgccttcccagatgaacggagccggcggcggcaacggatccgga
acgggtggcgacgacggcagtggcaacggctcaggagcgggcaacagaatcagcatgaac
accattgcgcagggcaatctgggaaacatggtgctgaccaacagcgttggcggcggcatg
ggcggcatggttaatcatcttaagcagcagcctggcggcggcggcggtggaatgatcaat
gccgtttcagtacccggaggtcctggagcaggagctggaggcgttggagctggcggcgga
ggagccgttaccgcaaaccaaggcatgcatatgcagaacggcccaatgatgggacgcatg
gtggggcaacagcatatgcttcgtggcccgcatctcatgggtgcctctggaggagctggt
gggccaggaaacgggcctggtggcggaggaccacgcatgcagaatccgaacatgcaaatg
actcaactcaacagtctgccctacggagtgggtcagtatggtggtccaggcggtggcaac
aatcctcagcaacagcagcagcaacagcagcaacaacttctcgcccagcagatggcccaa
agaggcggcgtcgtaccgggcatgccgcagggtaatcggcccgttggcacagtggtgccc
atgtccacactcggcggcgatggatcagggcccacggggcagctggtaagcgggaatcct
cagcagcaacagatgctggcgcagcagcaaaccggagccatgggcccgcgtcctccgcaa
ccaaaccagttgctcggtcatcccggccagcagcagcagcaacagcagcctggcacctcg
cagcagcagcaacagcagcagggagtcggaatcggaggagcaggcgttgtggccaatgca
ggaaccgttgctggcgtgccggcagtggcaggcggcggagccggtggcgccgtgcaatct
agcggccctggtggcgccaatcgcgatgtgcccgacgaccgtaagcgacagatccagcag
caactgatgctgctcctccatgcacacaaatgcaatcgcagggagaacctgaatccgaac
agggaagtgtgcaacgtcaactactgcaaggcgatgaaatccgtgctggcccacatgggc
acttgcaaacagagcaaggactgcaccatgcagcattgtgcctcctcgcgccaaatccta
ttgcattacaaaacgtgcacaaaacatctggaagccctgaatgcgggggctggagcgccg
ggagctggaggatccgcctccaatgtgacggtttcagctccgagcccatcacctggcttc
ctgtccaacggcccgtcgattggcacgccctccaacaataataatagtagtagtgctaac
aacaacccgccctcggtgagcagcctaatgcaacagccgctgagcaatcggccgggtacg
cctccttacatacccgcctccccagtgccggcgacaagtgcgtccggattagcggctagc
agtacgcccgcatcagcagcagccacctgtgcgagtagtggcagtggcagcaatagcagc
agtggagcaactgcagcgggtgcaagttccacgtcatcatcttcctcggcgggctcgggt
acaccactcagctcggtatcgactcctacatcggccacgatggccaccagcagcggtggt
ggtggcaatgcaggaggcggatcatccactacgcccgctagcaatccactgctcctcatg
tctggaggaacggcaggaggcggaacgggagcgacgaccaccacatcgacatcctcgagc
agtcgcatgatgagcagctccagcagtctctcctctcagatggctgccctggaggctgcg
gcgcgagacaacgatgatgagacgccctcgccatccggcgagaatacaaacggcagtggt
ggcagtggaaatgccggcggtatggcctctaagggcaaactggactccattaagcaagat
gacgatatcaagaaggagtttatggatgacagctgtggcggaaataacgatagctcgcag
atggattgctcgacgggtggtggcaagggcaagaatgtgaacaacgacggaaccagcatg
atcaaaatggagatcaagacggaggagggactcgatggcgaggtgaagatcaaaacggaa
gccatggatgtggacgaggctggaggatcgacagccggagagcatcatggcgaaggtggc
ggcggcagtggtgttggcggcggcaaggacaacatcaatggtgcgcacgatagcggagcg
acaggcggtgctgtggacataaaacccaagacggatacgaaaccactcgtaccggagcca
ctggcaccgaatgcgggtgacaagaaaaagaagtgccaattcaatcccgaggaactgcgc
accgctctcctgcctacgctagagaagctctacaggcaggagcccgaatccgtgcccttt
cgctacccagttgatccccaggcgctgggcattcccgattactttgagatcgttaagaag
cccatggacctgggcaccatacgcaccaacatccagaatggaaagtacagtgatccctgg
gagtatgtggacgacgtttggctgatgttcgacaatgcctggctgtataatcgcaaaaca
tcgcgggtctatcgctattgcacaaaggcggagattgatcctgtgatgcaggcactggga
tattgctgcggcaggaagtacacatttaatccacaggtgctctgctgctacggcaagcag
ctctgcacgattccgcgggatgccaagtactacagctaccagaacagtctaaaggaatac
ggtgtcgcctcaaatagatacacctactgccaaaagtgctttaacgacatccagggcgat
acggtcacactgggcgacgatccactgcaatcgcaaacccaaatcaaaaaggatcagttc
aaggagatgaagaacgatcatctcgaactggagccgtttgtcgattgccaggagtgcgga
cgcaaacagcaccagatctgcgtgctctggctggattcaatttggcccggtggcttcgtg
tgcgataactgcctgaaaaagaagaactcaaagcggaaggagaacaagttcaatgcgaaa
cgcctgcccaccaccaagctgggcgtgtacatagagacgcgggtgaataatttcctcaag
aagaaggaggctggtgccggcgaggtgcacattcgtgtggtcagctcatcggacaagtgt
gtagaggtgaagcccggcatgcgtcgacgattcgtcgagcagggcgagatgatgaacgag
ttcccatatcgcgccaaagccctctttgccttcgaggaggtggacggcatcgatgtgtgc
ttctttggcatgcacgttcaggagtatggatccgagtgcccggcgccgaatacgcggcgt
gtttacattgcctatttggattccgttcatttcttccggccaagacagtaccgtacagcg
gtatatcacgaaattctgctcggctacatggactacgtgaaacagctgggctacacaatg
gcccatatctgggcctgtccgccatccgagggggatgactacatcttccactgccatccc
acggaccagaagatacccaagcccaagcgcctgcaggagtgggcgacttctgcccatgtg
ctggaggagagcatcaaggaactggaccaggaggaggaggagaagcgcaagcaggccgag
gccgcggaagcagcagctgcggcaaatcttttctcaatcgaggagaacgaagtcagcggc
gatggcaaaaagaagggccagaagaaggccaaaaagtcgaacaaatcgaaagcggcgcag
cgtaagaacagcaaaaagtccaacgaacatcagtcgggcaacgatctctccgccaagata
tatgcgaccatggagaagcacaaggaggtcttcttcgtcatccgtctgcattcggcgcag
tcggcagctagtttagcgcccatccaggatcccgatccgctgctcacatgcgatctgatg
gatggacgcgatgccttcctcaccctcgcccgcgacaagcactttgagttctcgtcgctg
cggcgcgcacagttctccactctgtccatgttgtatgagctgcataaccagggtcaggac
aagttcgtttacacctgcaaccactgcaagacggccgtggagacgcgctaccactgtact
gtttgtgatgacttcgatctgtgtatcgtgtgcaaggagaaggttggccatcagcacaag
atggagaagctcggcttcgacatcgacgacggctctgcgctggcggatcacaagcaggct
aatccgcaggaggcccgcaagcaatccgtccagcgttgcatccaatcgctggtgcacgcc
tgccagtgtcgcgatgccaactgccgcctgccatcgtgccagaagatgaagcgcgtcgtc
cagcacacgaagaactgcaaacgcaagcccaacggaggatgccccatctgcaagcagctt
atcgcactctgttgctaccacgccaagaactgtgaggagccgaagtgccccgtgccgttc
tgtcccaacatcaagcacaagctcaagcagcagcagtcccagcagaaattccagcagcag
cagttgctgcgtcgccgtgtggcgctcatgtcgcgtacatctacagctccagcggctctg
caaggcccagctgcagtaagcggtccgaccgtcgtctctggaggagtgcccgtggtgggc
atgtccggtgtgacagttagccaaccggttatccccggccaggcgggtatactacctcca
ggggcgggtggcatgtcgccatctacagtggcagttccatcgcctgtttcaggaggagcg
ggagtcggtggaatgggtggaatgacatcaccacatccgcatcaaccaggcataggtatg
aaaccaggtggcggtcactcgccgtcgccaaatgtcctacaagtggtgaagcaggtccag
gaagaggcagctcgtcagcaggtttcgcatggcggtggcttcggcaagggcgtacccatg
gcgccgcccgtaatgaatcgtccaatgggcggcgcaggacccaaccaaaatgttaatcaa
cttggtggcatgggcgttggagttggaggtgtcggtggtgttggcgtcggaggcgttggt
ggagtgggtgttaatcaactgaattcgggtggtggcaatacaccgggtgcccccatttcc
ggtcccggaatgaatgtgaatcatctgatgtccatggatcagtggggcggtggcggagcc
ggcggcggaggtgccaatcccggcggaggcaacccacaagcccgctatgccaacaatacc
ggcggcatgcgccagcccacacaggtgatgcaaacgaatctgataccgccgcagcaacag
caacagatgatgggcggactgggcggacccaaccaactgggaggtggtcaaatgccagtc
ggcggacagcacggaggaatgggaatgggcatgggagccccgccaatggccggaactgtt
ggcggggtgcgtccatctcccggagcaggaggtggaggtggaagtgcaactgggggcggt
ctaaatacccaacaactcgcccagattatgcagaagattaagaacaatcccaccaacgag
agcaaccagcacatccttgccatactgaaacagaatccgcagatcatggcggcgatcatc
aagcagcgccagcagtcgcagatcaatgcgggcggaggagctcctggccccggtggagcc
ttacagcagcagcaggctggtaacggaccgcaaaatcctcaacagcagcagcagcagcaa
caacagcagcagcagcaacaggtgatgcagcaacagcagatgcagcacatgatgaaccag
cagcagggcgccggcggtccccagcagatgaatcccaaccagcagcagcaacagcagcag
gttaatctcatgcagcaacagcaacaaggtggacccggaggaccaggttctggacttccc
acgcgcatgcccaacatgcccaatgccttgggcatgctgcaaagtcttccgcccaacatg
tcgccaggcgtttccactcagggaggaatggtgcccaaccaaaactggaacaagatgcgt
tacatgcaaatgagccagtacccgccaccgtatccgcagcgccagcgtggtccgcacatg
ggcggagcgggacctggccccggccagcaacagttccccggtggcggaggtggagcgggc
aacttcaatgcaggtggtgctggtggtgcaggcggcgttgtcggtgtgggcggagtgccc
ggaggagccggcacggtgcccggcggcgatcagtactcgatggcgaatgcggccgctgcc
tccaatatgctgcaacagcagcagggccaggtgggcgtcggagtgggtgtgggcgtgaaa
ccaggacccggccaacagcaacagcagatgggcgttggcatgccgccgggtatgcagcag
caacagcagcaacagcaaccgctgcagcagcagatgatgcaggtggcgatgccaaatgcg
aatgcccagaatccgtcggcggtggtgggcggacccaatgctcaggtgatgggtccgccg
acgccgcactctctgcagcagcagctgatgcaatcggcccgctcatcgccgcccattcgc
tccccgcagccaacgccatcgccacgttcggctccatcgccacgtgctgctccctccgcc
tcgcctagggcacagccctcgccgcatcatgtgatgagcagtcactcgccggcgccgcag
ggaccaccgcatgacggcatgcacaatcatggcatgcatcatcagtcgccactgccagga
gtgccgcaggatgttggcgtcggagtcggtgtcggtgtcggtgttggcgttaacgttaac
gtcggcaacgtgggtgtcggcaatgccggaggagccctgcccgacgcctccgaccagctg
accaagtttgtggagcgactctag

DBGET integrated database retrieval system