KEGG   Drosophila simulans: Dsimw501_GD16050Help
Entry
Dsimw501_GD16050  CDS       T01065                                 

Gene name
Dsim_GD16050
Definition
(RefSeq) GD16050 gene product from transcript GD16050-RB (EC:2.3.1.48)
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsimw501_GD16050 (Dsim_GD16050)
   04330 Notch signaling pathway
    Dsimw501_GD16050 (Dsim_GD16050)
   04350 TGF-beta signaling pathway
    Dsimw501_GD16050 (Dsim_GD16050)
   04068 FoxO signaling pathway
    Dsimw501_GD16050 (Dsim_GD16050)
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsimw501_GD16050 (Dsim_GD16050)
Transcription factors [BR:dsi03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dsimw501_GD16050 (Dsim_GD16050)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dsimw501_GD16050 (Dsim_GD16050)
Mitochondrial biogenesis [BR:dsi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dsimw501_GD16050 (Dsim_GD16050)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 3265 aa AA seqDB search
MMADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSNSGWSDQLTGGAGGGNGGGGASGV
TTNPTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVGVGGVVGVGVVPSQMNGAGGGNGSG
TGGDDGSGNGSGAGNRISQMQHQQLQHLLQQQQQGQKGAMVVPGMQQLGSKSPNLQSPNQ
GGMQQVVGTQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLGNMVLTNSVGGGMGGMV
NHLKQQPGGGGGGMINAVSVPGGPGAGAGGVGAGGGGAVTANQGMHMQNGPMMGRMVGQQ
HMLRGPHLMGASGGAGGPGNGPGGGGPRMQNPNMQMTQLNSLPYGVGQYGGPGGGNNPQQ
QQQQQQQQLLAQQMAQRGGVVPGMPQGNRPVGTVVPMSTLGGDGSGPTGQLVSGNPQQQQ
MLAQQQTGAMGPRPPQPNQLLGHPGQQQQQQQPGTSQQQQQQQGVGIGGAGVVANAGTVA
GVPAVAGGGAGGAVQSSGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVC
NVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCTNSGCVICYPFRQNHSNI
NIITPHAALDMPISGRLIRCYWKFRGRPGKQQQQQQQQQQQNQQPNLTGLVVDGKQGQQV
APGGGQNTAIVLPQQQGAGGAPGAPKTPADMVQQLTQQQQQQQVHQQQVQQQELRRFDGM
GQVGLSPVPAGGMQQQQQQGLAPVIRIQGAQPAVRVLGPGGPGGPSGPNVLPNDVNSLHQ
QQQQMLQQQQQQGQNRRRGGLATMVEQQQQHQQQQQQPNPAQLGGNIPAPLSVNVGGFGN
TNFGGAAAGGAVGANDKQQLKVAQVHPQSHGVGAGGASAGAGASGGQVAAGSSVLMPADT
TGSGNAVNPSQNAGGGAGGAGGGNGGNSGPXFEPLGPVAEIRRESVTADLRNHLVHKLVQ
AIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQKELEEKRL
KRKEQHQQMMLQQQGVANPVAGGAAGGAGSAAGVAGGVVLPQQQQQQQQQQQQGQQPLQS
CIHPSISPMGGVMPPQQLRPQGPPGILGQQTAAGLGVGVGVTNNMVTMRSHSPGGNMLAL
QQQQRMQFPQQQQQQPPGSGAGKILVGPPGPSPGGMVVNPALSPYQTTNVLTSPVQGQQQ
QQQFINANGGTGANPQLSEIMKQRHIHQQQQQQQQQQQQQGMLLPQSPFSNATPLQQQQQ
QQATSNSFSSPMQQQQQQQGQQQQQQKPGSVLNNMPPTPTSLEALNAGAGAPGAGGSASN
VTVSAPSPSPGFLSNGPSIGTPSNNNNSSSANNNPPSVSSLMQQPLSNRPGTPPYIPASP
VPATSASGLAASSTPASAAATCASSGSGSNSSSGATAAGASSTSSSSSAGSGTPLSSVST
PTSATMATSSGGGGNAGGGSSTTPASNPLLLMSGGTAGGGTGATTTTSTSSSSRMMSSSS
SLSSQMAALEAAARDNDDETPSPSGENTNGSGGSGNAGGMASKGKLDSIKQDDDIKKEFM
DDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSMIKMEIKTEEGLDGEVKIKTEAMDVDEAG
GSTAGEHHGEGGGGSGVGGGKDNINGAHDSGATGGAVDIKPKTDTKPLVPEPLAPNAGDK
KKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIR
TNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYC
CGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASNRYTYCQKCFNDIQGDTV
TLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVDCQECGRKQHQICVLWLDSIWPGGFVCD
NCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVE
VKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVY
IAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTD
QKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLE
ESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQKKAKKSNKSKAAQRK
NSKKSNEHQSGNDLSAKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDG
RDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTAVETRYHCTVC
DDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQSVQRCIQSLVHACQ
CRDANCRLPSCQKMKRVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEPKCPVPFCP
NIKHKLKQQQSQQKFQQQQLLRRRVALMSRTSTAPAALQGPAAVSGPTVVSGGVPVVGMS
GVTVSQPVIPGQAGILPPGAGGMSPSTVAVPSPVSGGAGVGGMGGMTSPHPHQPGIGMKP
GGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPPVMNRPMGGAGPNQNVNQLG
GMGVGVGGVGGVGVGGVGGVGVNQLNSGGGNTPGAPISGPGMNVNHLMSMDQWGGGGAGG
GGANPGGGNPQARYANNTGGMRQPTQVMQTNLIPPQQQQQMMGGLGGPNQLGGGQMPVGG
QHGGMGMGMGAPPMAGTVGGVRPSPGAGGGGGSATGGGLNTQQLAQIMQKIKNNPTNESN
QHILAILKQNPQIMAAIIKQRQQSQINAGGGAPGPGGALQQQQAGNGPQNPQQQQQQQQQ
QQQQQVMQQQQMQHMMNQQQGAGGPQQMNPNQQQQQQQVNLMQQQQQGGPGGPGSGLPTR
MPNMPNALGMLQSLPPNMSPGVSTQGGMVPNQNWNKMRYMQMSQYPPPYPQRQRGPHMGG
AGPGPGQQQFPGGGGGAGNFNAGGAGGAGGVVGVGGVPGGAGTVPGGDQYSMANAAAASN
MLQQQQGQVGVGVGVGVKPGPGQQQQQMGVGMPPGMQQQQQQQQPLQQQMMQVAMPNANA
QNPSAVVGGPNAQVMGPPTPHSLQQQLMQSARSSPPIRSPQPTPSPRSAPSPRAAPSASP
RAQPSPHHVMSSHSPAPQGPPHDGMHNHGMHHQSPLPGVPQDVGVGVGVGVGVGVNVNVG
NVGVGNAGGALPDASDQLTKFVERL
NT seq 9798 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgccccaaaagcgggttaaaatggatccaacggac
atctcttactttctggaggagaacctgcccgatgagctggtgtcctcgaacagtggttgg
tcggatcagctgaccggcggagcaggcggtggcaatggaggtggcggcgcctccggtgta
accacaaaccccacatccggcccaaatcccggtggaggacccaacaagccggcagcccaa
ggacccggctctggcacaggcggagtcggtgttggagtcaatgtgggtgtcggcggtgtt
gttggcgtcggcgttgtgccttcccagatgaacggagccggcggcggcaacggatccgga
acgggtggcgacgacggcagtggcaacggctcaggagcgggcaacagaatcagtcaaatg
cagcaccagcaactgcagcacctactccagcaacagcagcagggccaaaagggcgccatg
gtggtgcccgggatgcagcagctgggcagcaagtcgcccaacctgcagtcacccaaccag
ggtggcatgcagcaggtggtgggcactcagatgggtatggtcaactcaatgcccatgtca
atatcgaataatggcaacaatggcatgaacgccataccaggcatgaacaccattgcgcag
ggcaatctgggaaacatggtgctgaccaacagcgttggcggcggcatgggcggcatggtt
aatcatcttaagcagcagcctggcggcggcggcggtggaatgatcaatgccgtttcagta
cccggaggtcctggagcaggagctggaggcgttggagctggcggcggaggagccgttacc
gcaaaccaaggcatgcatatgcagaacggcccaatgatgggacgcatggtggggcaacag
catatgcttcgtggcccgcatctcatgggtgcctctggaggagctggtgggccaggaaac
gggcctggtggcggaggaccacgcatgcagaatccgaacatgcaaatgactcaactcaac
agtctgccctacggagtgggtcagtatggtggtccaggcggtggcaacaatcctcagcaa
cagcagcagcaacagcagcaacaacttctcgcccagcagatggcccaaagaggcggcgtc
gtaccgggcatgccgcagggtaatcggcccgttggcacagtggtgcccatgtccacactc
ggcggcgatggatcagggcccacggggcagctggtaagcgggaatcctcagcagcaacag
atgctggcgcagcagcaaaccggagccatgggcccgcgtcctccgcaaccaaaccagttg
ctcggtcatcccggccagcagcagcagcaacagcagcctggcacctcgcagcagcagcaa
cagcagcagggagtcggaatcggaggagcaggcgttgtggccaatgcaggaaccgttgct
ggcgtgccggcagtggcaggcggcggagccggtggcgccgtgcaatctagcggccctggt
ggcgccaatcgcgatgtgcccgacgaccgtaagcgacagatccagcagcaactgatgctg
ctcctccatgcacacaaatgcaatcgcagggagaacctgaatccgaacagggaagtgtgc
aacgtcaactactgcaaggcgatgaaatccgtgctggcccacatgggcacttgcaaacag
agcaaggactgcaccatgcagcattgtgcctcctcgcgccaaatcctattgcattacaaa
acgtgcacaaacagtggctgcgtcatttgctatcccttccggcagaatcattccaacatt
aacatcatcactccacacgcagctctggatatgcccatatccggacgattaatcagatgt
tattggaaattcaggggacgccccggtaaacagcagcagcagcaacaacaacagcagcag
cagaaccagcagcccaatctgacgggtctggtggtggatggcaagcagggacagcaggtt
gcaccgggaggtggccaaaatactgccatagttcttccccagcagcagggagcgggcggt
gcaccgggtgcgccgaaaacgcctgcggatatggtgcaacaattgacccaacagcagcag
caacagcaggtgcaccagcagcaggttcagcagcaagaactccgtcgattcgatggcatg
ggccaagttggactatcgccggtgccagcaggtggtatgcaacagcagcagcagcagggt
ttggctcctgtgattcgcattcaaggcgctcagccggccgtcagggtcctgggaccaggt
ggtcccggcggcccaagtggaccaaatgttctgccgaacgatgttaacagcctgcatcaa
caacagcaacaaatgctgcaacagcagcagcaacaaggccagaatcgacgacgcggtggc
cttgccaccatggtggagcaacaacagcagcatcaacaacaacagcagcaacccaatccc
gcccagctgggtggcaacattccagcaccactctctgtcaacgtcggtggctttggcaat
accaatttcggtggtgcagcagccggcggagccgtgggagccaacgataagcagcaactg
aaggtggcccaagtgcatccgcagagccatggcgtaggagcgggcggagcatcagcgggc
gccggagcgagtggtggtcaagtggcagccggttccagtgtcctgatgccagccgatacc
acgggcagtggtaatgcggtcaatcccagccagaatgccggcggtggagctggaggtgcc
ggcggtggcaatggcggaaactctggaccatgatttgagccactgggccccgtagcggaa
atcaggcgggaatcggtgaccgccgatctgcgcaaccacctcgtccacaaactggtgcag
gccatcttccccacctcggatcccacgaccatgcaggacaaacggatgcataatctcgtt
tcatacgcggaaaaggtcgagaaggacatgtacgaaatggccaagtccagatcggagtac
tatcacctgctggccgagaagatctacaagattcaaaaggagctggaggagaagcgtctg
aagcgtaaggaacagcaccagcagatgatgctgcagcagcagggcgttgcgaatccagtg
gctggaggagcggctggcggagcaggcagtgcagctggcgtagcgggcggtgttgtcttg
ccccagcagcaacagcagcagcaacaacagcagcagcagggtcagcagcctctgcagagc
tgtatccatcccagcatcagtccaatgggcggtgtgatgccgccgcagcagctgcgtcca
caaggaccacctgggatattgggccagcagacggcagcaggcctgggcgtcggcgtggga
gtgaccaacaacatggttaccatgcgcagtcattcgcccggtggcaacatgctcgccctg
cagcaacaacagcgcatgcagttcccgcaacaacagcagcaacaaccacccgggtctgga
gccggcaaaatactggtcggtccaccaggacccagtcccggtggcatggtggtcaatccc
gcgctctcgccttaccagacgaccaatgtgctcaccagtccggtacaaggacagcagcaa
cagcagcagttcattaatgcgaacggcggcactggcgccaatcctcagctgagcgagatc
atgaagcaacgacatattcaccagcagcagcagcaacaacagcaacagcagcagcagcaa
ggaatgttgttgccgcagtcgccatttagcaatgccacacctctacaacaacagcagcag
cagcaggcgactagcaacagctttagctcaccaatgcagcagcaacagcagcagcaaggt
cagcaacagcaacaacagaagcctggcagtgtgctgaataatatgccgcccacgcccacg
agtctggaagccctgaatgcgggggctggagcgccgggagctggaggatccgcctccaat
gtgacggtttcagctccgagcccatcacctggcttcctgtccaacggcccgtcgattggc
acgccctccaacaataataatagtagtagtgctaacaacaacccgccctcggtgagcagc
ctaatgcaacagccgctgagcaatcggccgggtacgcctccttacatacccgcctcccca
gtgccggcgacaagtgcgtccggattagcggctagcagtacgcccgcatcagcagcagcc
acctgtgcgagtagtggcagtggcagcaatagcagcagtggagcaactgcagcgggtgca
agttccacgtcatcatcttcctcggcgggctcgggtacaccactcagctcggtatcgact
cctacatcggccacgatggccaccagcagcggtggtggtggcaatgcaggaggcggatca
tccactacgcccgctagcaatccactgctcctcatgtctggaggaacggcaggaggcgga
acgggagcgacgaccaccacatcgacatcctcgagcagtcgcatgatgagcagctccagc
agtctctcctctcagatggctgccctggaggctgcggcgcgagacaacgatgatgagacg
ccctcgccatccggcgagaatacaaacggcagtggtggcagtggaaatgccggcggtatg
gcctctaagggcaaactggactccattaagcaagatgacgatatcaagaaggagtttatg
gatgacagctgtggcggaaataacgatagctcgcagatggattgctcgacgggtggtggc
aagggcaagaatgtgaacaacgacggaaccagcatgatcaaaatggagatcaagacggag
gagggactcgatggcgaggtgaagatcaaaacggaagccatggatgtggacgaggctgga
ggatcgacagccggagagcatcatggcgaaggtggcggcggcagtggtgttggcggcggc
aaggacaacatcaatggtgcgcacgatagcggagcgacaggcggtgctgtggacataaaa
cccaagacggatacgaaaccactcgtaccggagccactggcaccgaatgcgggtgacaag
aaaaagaagtgccaattcaatcccgaggaactgcgcaccgctctcctgcctacgctagag
aagctctacaggcaggagcccgaatccgtgccctttcgctacccagttgatccccaggcg
ctgggcattcccgattactttgagatcgttaagaagcccatggacctgggcaccatacgc
accaacatccagaatggaaagtacagtgatccctgggagtatgtggacgacgtttggctg
atgttcgacaatgcctggctgtataatcgcaaaacatcgcgggtctatcgctattgcaca
aagctttccgaagtctttgaggcggagattgatcctgtgatgcaggcactgggatattgc
tgcggcaggaagtacacatttaatccacaggtgctctgctgctacggcaagcagctctgc
acgattccgcgggatgccaagtactacagctaccagaacagtctaaaggaatacggtgtc
gcctcaaatagatacacctactgccaaaagtgctttaacgacatccagggcgatacggtc
acactgggcgacgatccactgcaatcgcaaacccaaatcaaaaaggatcagttcaaggag
atgaagaacgatcatctcgaactggagccgtttgtcgattgccaggagtgcggacgcaaa
cagcaccagatctgcgtgctctggctggattcaatttggcccggtggcttcgtgtgcgat
aactgcctgaaaaagaagaactcaaagcggaaggagaacaagttcaatgcgaaacgcctg
cccaccaccaagctgggcgtgtacatagagacgcgggtgaataatttcctcaagaagaag
gaggctggtgccggcgaggtgcacattcgtgtggtcagctcatcggacaagtgtgtagag
gtgaagcccggcatgcgtcgacgattcgtcgagcagggcgagatgatgaacgagttccca
tatcgcgccaaagccctctttgccttcgaggaggtggacggcatcgatgtgtgcttcttt
ggcatgcacgttcaggagtatggatccgagtgcccggcgccgaatacgcggcgtgtttac
attgcctatttggattccgttcatttcttccggccaagacagtaccgtacagcggtatat
cacgaaattctgctcggctacatggactacgtgaaacagctgggctacacaatggcccat
atctgggcctgtccgccatccgagggggatgactacatcttccactgccatcccacggac
cagaagatacccaagcccaagcgcctgcaggagtggtacaaaaagatgcttgacaagggc
atgatcgagcgcatcatacaggactacaaggatatcctgaagcaggcgatggaggacaaa
ctgggctctgccgcagagctgccctactttgagggcgacttctggcccaatgtgctggag
gagagcatcaaggaactggaccaggaggaggaggagaagcgcaagcaggccgaggccgcg
gaagcagcagctgcggcaaatcttttctcaatcgaggagaacgaagtcagcggcgatggc
aaaaagaagggccagaagaaggccaaaaagtcgaacaaatcgaaagcggcgcagcgtaag
aacagcaaaaagtccaacgaacatcagtcgggcaacgatctctccgccaagatatatgcg
accatggagaagcacaaggaggtcttcttcgtcatccgtctgcattcggcgcagtcggca
gctagtttagcgcccatccaggatcccgatccgctgctcacatgcgatctgatggatgga
cgcgatgccttcctcaccctcgcccgcgacaagcactttgagttctcgtcgctgcggcgc
gcacagttctccactctgtccatgttgtatgagctgcataaccagggtcaggacaagttc
gtttacacctgcaaccactgcaagacggccgtggagacgcgctaccactgtactgtttgt
gatgacttcgatctgtgtatcgtgtgcaaggagaaggttggccatcagcacaagatggag
aagctcggcttcgacatcgacgacggctctgcgctggcggatcacaagcaggctaatccg
caggaggcccgcaagcaatccgtccagcgttgcatccaatcgctggtgcacgcctgccag
tgtcgcgatgccaactgccgcctgccatcgtgccagaagatgaagcgcgtcgtccagcac
acgaagaactgcaaacgcaagcccaacggaggatgccccatctgcaagcagcttatcgca
ctctgttgctaccacgccaagaactgtgaggagccgaagtgccccgtgccgttctgtccc
aacatcaagcacaagctcaagcagcagcagtcccagcagaaattccagcagcagcagttg
ctgcgtcgccgtgtggcgctcatgtcgcgtacatctacagctccagcggctctgcaaggc
ccagctgcagtaagcggtccgaccgtcgtctctggaggagtgcccgtggtgggcatgtcc
ggtgtgacagttagccaaccggttatccccggccaggcgggtatactacctccaggggcg
ggtggcatgtcgccatctacagtggcagttccatcgcctgtttcaggaggagcgggagtc
ggtggaatgggtggaatgacatcaccacatccgcatcaaccaggcataggtatgaaacca
ggtggcggtcactcgccgtcgccaaatgtcctacaagtggtgaagcaggtccaggaagag
gcagctcgtcagcaggtttcgcatggcggtggcttcggcaagggcgtacccatggcgccg
cccgtaatgaatcgtccaatgggcggcgcaggacccaaccaaaatgttaatcaacttggt
ggcatgggcgttggagttggaggtgtcggtggtgttggcgtcggaggcgttggtggagtg
ggtgttaatcaactgaattcgggtggtggcaatacaccgggtgcccccatttccggtccc
ggaatgaatgtgaatcatctgatgtccatggatcagtggggcggtggcggagccggcggc
ggaggtgccaatcccggcggaggcaacccacaagcccgctatgccaacaataccggcggc
atgcgccagcccacacaggtgatgcaaacgaatctgataccgccgcagcaacagcaacag
atgatgggcggactgggcggacccaaccaactgggaggtggtcaaatgccagtcggcgga
cagcacggaggaatgggaatgggcatgggagccccgccaatggccggaactgttggcggg
gtgcgtccatctcccggagcaggaggtggaggtggaagtgcaactgggggcggtctaaat
acccaacaactcgcccagattatgcagaagattaagaacaatcccaccaacgagagcaac
cagcacatccttgccatactgaaacagaatccgcagatcatggcggcgatcatcaagcag
cgccagcagtcgcagatcaatgcgggcggaggagctcctggccccggtggagccttacag
cagcagcaggctggtaacggaccgcaaaatcctcaacagcagcagcagcagcaacaacag
cagcagcagcaacaggtgatgcagcaacagcagatgcagcacatgatgaaccagcagcag
ggcgccggcggtccccagcagatgaatcccaaccagcagcagcaacagcagcaggttaat
ctcatgcagcaacagcaacaaggtggacccggaggaccaggttctggacttcccacgcgc
atgcccaacatgcccaatgccttgggcatgctgcaaagtcttccgcccaacatgtcgcca
ggcgtttccactcagggaggaatggtgcccaaccaaaactggaacaagatgcgttacatg
caaatgagccagtacccgccaccgtatccgcagcgccagcgtggtccgcacatgggcgga
gcgggacctggccccggccagcaacagttccccggtggcggaggtggagcgggcaacttc
aatgcaggtggtgctggtggtgcaggcggcgttgtcggtgtgggcggagtgcccggagga
gccggcacggtgcccggcggcgatcagtactcgatggcgaatgcggccgctgcctccaat
atgctgcaacagcagcagggccaggtgggcgtcggagtgggtgtgggcgtgaaaccagga
cccggccaacagcaacagcagatgggcgttggcatgccgccgggtatgcagcagcaacag
cagcaacagcaaccgctgcagcagcagatgatgcaggtggcgatgccaaatgcgaatgcc
cagaatccgtcggcggtggtgggcggacccaatgctcaggtgatgggtccgccgacgccg
cactctctgcagcagcagctgatgcaatcggcccgctcatcgccgcccattcgctccccg
cagccaacgccatcgccacgttcggctccatcgccacgtgctgctccctccgcctcgcct
agggcacagccctcgccgcatcatgtgatgagcagtcactcgccggcgccgcagggacca
ccgcatgacggcatgcacaatcatggcatgcatcatcagtcgccactgccaggagtgccg
caggatgttggcgtcggagtcggtgtcggtgtcggtgttggcgttaacgttaacgtcggc
aacgtgggtgtcggcaatgccggaggagccctgcccgacgcctccgaccagctgaccaag
tttgtggagcgactctag

DBGET integrated database retrieval system