KEGG   Drosophila simulans: Dsimw501_GD16099Help
Entry
Dsimw501_GD16099  CDS       T01065                                 

Gene name
Dsim_GD16099
Definition
(RefSeq) GD16099 gene product from transcript GD16099-RA (EC:3.1.2.22)
  KO
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dsi  Drosophila simulans
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dsimw501_GD16099 (Dsim_GD16099)
  Lipid metabolism
   00062 Fatty acid elongation
    Dsimw501_GD16099 (Dsim_GD16099)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsimw501_GD16099 (Dsim_GD16099)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dsimw501_GD16099 (Dsim_GD16099)
Lipid biosynthesis proteins [BR:dsi01004]
 Fatty acid synthase
  Component type
   Dsimw501_GD16099 (Dsim_GD16099)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 314 aa AA seqDB search
MISVCFSRCSCILYFVLLIVAFVLGYIWWSPTKGGTNPDVLPVVLWHGMGDTCCVPFSLG
GIMSLIVEQTKGGYVRSLEIGGNVVMDWESGFFIHPNEQVDYVCKQLLQDEHLAKGYHAI
GFSQGGQFLRAVAERCPNPPMRNLITLGGQHQGIFGLPMCPTLTEASCDYITRLLDNAAY
APEVQRSLVQATYWHDPIMENKYRMGSTFLSDINNELYINEFYIENLHKLKKFVMVQFLN
DTIVQPKESQWFQYYTTGQNKVIQPFTESKVYKDLGLDEMHRQGKLVFLGVEGDHLAISK
AWFIKNIVPLLLEK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatttctgtctgcttttctcgttgttcatgcattttatattttgtgctcctgatcgtg
gccttcgtgcttggctacatatggtggagcccgacgaaaggaggaaccaatccggacgtc
ctgccggtcgttctgtggcacggaatgggcgatacctgctgcgtgcccttcagcctgggt
ggcattatgagcctgatcgtggagcagacaaagggcggctatgtgcgatccctggagatc
ggcggcaatgttgtgatggactgggagagcggctttttcatacatcccaacgaacaggtg
gattacgtttgcaagcaactactgcaggatgagcacctggccaagggataccacgccatc
ggattctcgcagggcggccagtttctgcgcgcggtggccgaacgttgtccgaatccgcca
atgaggaacctcatcaccctcggtggacagcaccagggcatattcgggctgcccatgtgc
cctaccctaaccgaagcgtcctgtgattacatcaccaggctacttgacaatgccgcctac
gcgcctgaagtgcagaggtcattggttcaggccacctactggcacgatccgatcatggag
aacaaataccgcatgggcagcacatttctctcggacattaacaatgagctctacatcaac
gagttctacattgagaacctgcacaagcttaagaaatttgtgatggtgcagttcctaaac
gacacgattgtccagccgaaggagtcccagtggtttcaatactacaccactgggcagaac
aaagtcatccagccctttactgagagcaaagtctacaaggatttgggactggacgagatg
catcgacaaggaaagcttgtctttctcggcgtcgaaggtgatcacttggccatatccaag
gcctggtttatcaagaacatagtgcctcttctactcgaaaaataa

DBGET integrated database retrieval system