KEGG   Drosophila simulans: Dsim_GD16099Help
Entry
Dsim_GD16099      CDS       T01065                                 

Definition
GD16099 gene product from transcript GD16099-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dsi  Drosophila simulans
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dsim_GD16099
  Lipid metabolism
   00062 Fatty acid elongation
    Dsim_GD16099
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsim_GD16099
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dsim_GD16099
Lipid biosynthesis proteins [BR:dsi01004]
 Fatty acid synthase
  Component type
   Dsim_GD16099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 266 aa AA seqDB search
MGDTCCVPFSLGGIMSLIVEQTKGGYVRSLEIGGNVVMDWESGFFIHPNEQVDYVCKQLL
QDEHLAKGYHAIGFSQGGQFLRAVAERCPNPPMRNLITLGGQHQGIFGLPMCPTLTEASC
DYITRLLDNAAYAPEVQRSLVQATYWHDPIMENKYRMGSTFLSDINNELYINEFYIENLH
KLKKFVMVQFLNDTIVQPKESQWFQYYTTGQNKVIQPFTESKVYKDLGLDEMHRQGKLVF
LGVEGDHLAISKAWFIKNIVPLLLEK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatacctgctgcgtgcccttcagcctgggtggcattatgagcctgatcgtggag
cagacaaagggcggctatgtgcgatccctggagatcggcggcaatgttgtgatggactgg
gagagcggctttttcatacatcccaacgaacaggtggattacgtttgcaagcaactactg
caggatgagcacctggccaagggataccacgccatcggattctcgcagggcggccagttt
ctgcgcgcggtggccgaacgttgtccgaatccgccaatgaggaacctcatcaccctcggt
ggacagcaccagggcatattcgggctgcccatgtgccctaccctaaccgaagcgtcctgt
gattacatcaccaggctacttgacaatgccgcctacgcgcctgaagtgcagaggtcattg
gttcaggccacctactggcacgatccgatcatggagaacaaataccgcatgggcagcaca
tttctctcggacattaacaatgagctctacatcaacgagttctacattgagaacctgcac
aagcttaagaaatttgtgatggtgcagttcctaaacgacacgattgtccagccgaaggag
tcccagtggtttcaatactacaccactgggcagaacaaagtcatccagccctttactgag
agcaaagtctacaaggatttgggactggacgagatgcatcgacaaggaaagcttgtcttt
ctcggcgtcgaaggtgatcacttggccatatccaaggcctggtttatcaagaacatagtg
cctcttctactcgaaaaataa

DBGET integrated database retrieval system