KEGG   Drosophila simulans: Dsim_GD16099Help
Entry
Dsim_GD16099      CDS       T01065                                 

Definition
GD16099 gene product from transcript GD16099-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dsi  Drosophila simulans
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dsi01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dsi00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dsi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 266 aa AA seqDB search
MGDTCCVPFSLGGIMSLIVEQTKGGYVRSLEIGGNVVMDWESGFFIHPNEQVDYVCKQLL
QDEHLAKGYHAIGFSQGGQFLRAVAERCPNPPMRNLITLGGQHQGIFGLPMCPTLTEASC
DYITRLLDNAAYAPEVQRSLVQATYWHDPIMENKYRMGSTFLSDINNELYINEFYIENLH
KLKKFVMVQFLNDTIVQPKESQWFQYYTTGQNKVIQPFTESKVYKDLGLDEMHRQGKLVF
LGVEGDHLAISKAWFIKNIVPLLLEK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatacctgctgcgtgcccttcagcctgggtggcattatgagcctgatcgtggag
cagacaaagggcggctatgtgcgatccctggagatcggcggcaatgttgtgatggactgg
gagagcggctttttcatacatcccaacgaacaggtggattacgtttgcaagcaactactg
caggatgagcacctggccaagggataccacgccatcggattctcgcagggcggccagttt
ctgcgcgcggtggccgaacgttgtccgaatccgccaatgaggaacctcatcaccctcggt
ggacagcaccagggcatattcgggctgcccatgtgccctaccctaaccgaagcgtcctgt
gattacatcaccaggctacttgacaatgccgcctacgcgcctgaagtgcagaggtcattg
gttcaggccacctactggcacgatccgatcatggagaacaaataccgcatgggcagcaca
tttctctcggacattaacaatgagctctacatcaacgagttctacattgagaacctgcac
aagcttaagaaatttgtgatggtgcagttcctaaacgacacgattgtccagccgaaggag
tcccagtggtttcaatactacaccactgggcagaacaaagtcatccagccctttactgag
agcaaagtctacaaggatttgggactggacgagatgcatcgacaaggaaagcttgtcttt
ctcggcgtcgaaggtgatcacttggccatatccaaggcctggtttatcaagaacatagtg
cctcttctactcgaaaaataa

DBGET integrated database retrieval system