KEGG   Drosophila simulans: Dsim_GD16213Help
Entry
Dsim_GD16213      CDS       T01065                                 

Definition
GD16213 gene product from transcript GD16213-RA
Orthology
K07204  
regulatory associated protein of mTOR
Organism
dsi  Drosophila simulans
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsim_GD16213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1161 aa AA seqDB search
MTSAVRAKSATAAVGVAVDESSGSSNGSVGDQDVASSKEAVLRYLIRTRYEQYVFAPWDD
PIILIMEQLEHIEHRRSAALGNQVAIGRDPSQEDSLNDLGKVISNMRQDQSLVPIVKHIE
QISDIQASNGQELASLGSLRELIQTIREEWPRDDSIKLRLKEIQILGMPPVWNLCFGERI
RDDRCPLSLQTKRHKERIQAMMYERQTWRIRERMKTASVALVLCLNIGVDPPDVVKIQPC
SRLECWIDPSSVSPPKAMELIGSNLQMQYERWQPRARYKKCNDPTVDDVKKLCTSLRRNA
KGERILFHYNGHGVPKPTANGEIWVFNKTFTQYIPLSIFELITWMSAPSIYVYDCSNAGI
IINSFQPYAKQHEEELEKALAAAQQRGGVQQLVGGSGGAANVAANQVQLTNQMVSYKNCI
HLAACAANEILPMNAQLPADLFTSCLTTPINIALKWYAMQEKLGMVPRIQSELIDKIPGK
VNDRRTMMGELNWIFTAITDTIAWNTLPRELFQRLFRQDLLVASLFRNFLLAERILRSHD
CTPVSLPALPPCYRHPMWKAWDLVVDLALQQLPEILDHNAPYRQLPFFEHQLTAFQVWLD
SESESRTPPEQLPIVLQVLLSQVHRLRALELLARFLDLGPWAVNLALGVGIFPYVLKLLQ
SSTRELRPVLVFIWAKILAVDPSCQVDLVKEYKYFLSVLQDTSVSKEHRTLSAFVLSSIV
HNFLLGQTSALQGPLLSICLEQLNDGSWLLRQWLAICLGMLWQNFEKARWSGARDLAHEK
LYVLLRDSIPEVRAAAVFALGTFISSVTDRSEEQANNIDRIIAITMLETVGEDMSPLVRM
ELAAALQWMVVLFESQFVAVYLAEHMRGHVSAASFVMCPDPRDLTSSTHSLERHVTIRRG
ASSSSISNMGGASTSSGTGSSSNPLGRSKSGSGSSGGRGAAGAAGGTNSIPFQSIFTKLW
LGICNLAQDPFPRVAAIAQEIVEHVRDTALCPIMAAKEATMANASEKCSSLSVSLPPSPN
TRVNYLSGGGAPGGAGATAESPPVGAAASGASHWAQKLRLSGSGACMAAGDPQTILQRKL
RTSSINDETDSGPAYSRGVAGAGAGLGLPSGPRESTHSARSSGSESNHYLEPGHSLTPIV
LTEFIPWAISYFTRARQGALQ
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtgccgttcgcgctaagtccgccactgccgcagtcggcgtcgcagtcgacgaa
agcagcggcagcagcaacggcagcgtcggggatcaggatgtggcctccagcaaggaagcc
gtcctgcgctatctaatccgcacgagatacgagcaatatgtattcgcaccgtgggacgat
cccataatcttgataatggagcaactggagcacatcgagcaccgtcgatccgccgccttg
gggaaccaggtggccatcggccgtgacccatctcaggaagactctctgaacgacctgggt
aaggtgattagcaacatgaggcaggaccagtcactggtacctatcgtgaagcacatcgag
caaatatccgacattcaggcctccaacggccaggaactggcctctctcggttctttgagg
gagctgatccagactatcagagaagagtggccccgggacgactctatcaagctgcggctg
aaggaaatacagatcctgggcatgccgcccgtgtggaacttatgcttcggcgagcgtatc
cgcgacgacagatgcccgctctccctgcagaccaagcggcacaaggagcgcattcaggcc
atgatgtacgagcgacagacgtggcgcatccgcgagcgcatgaagacggcaagtgtggcc
ctggttctatgcctcaacatcggcgtggatccgccggacgtggtcaagatccaaccttgc
tcacggcttgagtgctggatagatcccagctcggtgtccccgccaaaggccatggaactc
attgggagcaacctgcagatgcagtacgaacgctggcagccaagggcccggtacaagaag
tgcaacgatcccaccgtggatgacgtgaagaagctctgcacctccctacgccggaacgcc
aagggggagcgcatactcttccactacaacgggcacggagtgcccaagcccacagccaac
ggggagatctgggtgttcaacaagactttcacgcagtacatccccctaagtatattcgag
cttatcacttggatgtcagcgccctccatctacgtgtatgactgctccaacgccgggatc
atcatcaattcgtttcagccatacgctaagcagcacgaggaagaactagagaaggcgctg
gccgccgcccagcagaggggtggtgtccaacagttagtgggcggctctggtggtgccgcc
aatgtagccgccaaccaggtgcagttaaccaaccagatggtcagttacaagaactgtata
cacctggcggcctgtgctgcaaacgaaattcttccgatgaatgcccagctgccggcggat
cttttcaccagctgtctgacaacacccattaacatagcgctcaagtggtacgccatgcaa
gaaaagctgggcatggtaccgcgtattcagagcgaactaatcgacaagattccaggcaag
gtcaacgaccggcgcactatgatgggtgagctcaactggatcttcaccgccattactgac
acgatagcatggaacacacttccccgcgagctctttcagcgcctgtttcgccaggatctg
ctggtggctagcctgtttcgcaatttcctgttggccgagcgcatactgcgcagccacgac
tgcacaccagtttccctgcccgccctgccgccttgctatcgccatccgatgtggaaggcc
tgggatctggtggtagatttggctctacagcagttgccggagatcctcgatcacaatgcg
ccgtaccgccagctgccgttcttcgagcaccagcttacggccttccaggtttggctggac
agcgaatcggagtcgagaacgccaccggaacagctgcccattgtgctgcaggtcctactg
tcgcaggtgcaccgtctgagggccctggagctgctggctcgctttctggatcttggtccg
tgggccgttaatctcgccctgggcgtgggcatctttccatacgtgctcaaactgctacag
agttctacgcgcgaactgcgacccgttttggtgttcatttgggccaagatcctggccgtg
gatcccagctgccaagtggatctggtcaaggaatacaagtacttcctctccgtgctgcag
gacacctccgtttccaaggagcaccgtacactgtccgcctttgtactgtcctccatagtg
cacaacttcctgctgggacagacgagcgcgcttcagggtcccctactgtctatttgcctg
gagcagctgaacgacggaagctggctgctgcgccagtggctagccatctgtctgggcatg
ctgtggcagaactttgagaaggcgcgttggtcgggagcacgcgacctcgcgcacgagaag
ctgtacgttctgctgcgggactcgattccggaagtacgagccgctgccgtcttcgcctta
ggcacgtttattagctccgtgacggatcgtagcgaggagcaggccaataacatcgatcgc
atcattgccattaccatgctcgaaaccgtgggcgaggatatgtcgccgctggtccgcatg
gagctggccgccgccctgcaatggatggtggtgctcttcgagtcacagttcgtggcagta
tatctagctgagcacatgcgcggtcacgtctccgccgcctcgttcgtgatgtgccccgat
ccccgggatctgacgtcttccacgcacagcctggagcgtcatgtgaccatccgcagggga
gctagctccagctccatatccaacatgggtggtgcgtcaacaagctcgggaacaggatca
tccagcaaccctttgggtcgctcgaagagtggctctggcagttcgggcggaagaggagca
gccggagctgcgggcggtactaacagcatacccttccagtcaatctttaccaagctctgg
ctgggcatctgcaatctggcccaggatccgtttcctcgtgtagcggccattgcccaggag
attgttgaacatgtgagggacacggcactgtgtcccatcatggccgccaaggaagcgacc
atggccaatgcctcggagaaatgcagcagcctaagtgtgagcctcccgcccagtccaaat
acaagagttaattacttgagcggtggcggcgcaccaggtggagctggcgcgactgcagaa
tcaccgcccgtcggagcagctgcctcgggcgccagtcactgggcgcaaaagctacgacta
tcaggcagtggagcctgcatggctgctggagatcctcaaaccattctgcagcgcaagctg
cgcacgagctccatcaacgatgagacggacagcggaccagcgtactccagaggagtcgcg
ggcgccggagctggtctgggactgcccagcggaccgagggagagcacccattcggcgcgg
agcagcggcagcgagagcaatcattacctggagccgggacacagcctcacgcctattgtc
ctgaccgaattcataccctgggccatttcctatttcacgcgggccaggcaaggagcgcta
cagtag

DBGET integrated database retrieval system