KEGG   Drosophila simulans: Dsimw501_GD16213Help
Entry
Dsimw501_GD16213  CDS       T01065                                 

Gene name
Dsim_GD16213
Definition
(RefSeq) GD16213 gene product from transcript GD16213-RB
  KO
K07204  
regulatory associated protein of mTOR
Organism
dsi  Drosophila simulans
Pathway
mTOR signaling pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsimw501_GD16213 (Dsim_GD16213)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dsimw501_GD16213 (Dsim_GD16213)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 1619 aa AA seqDB search
MTSAVRAKSATAAVGVAVDESSGSSNGSVGDQDVASSKEAVLRYLIRTRYEQYVFAPWDD
PIILIMEQLEHIEHRRSAALGNQVAIGRDPSQEDSLNDLGKVISNMRQDQSLVPIVKHIE
QISDIQASNGQELASLGSLRELIQTIREEWPRDDSIKLRLKEIQILGMPPVWNLCFGERI
RDDRCPLSLQTKRHKERIQAMMYERQTWRIRERMKTASVALVLCLNIGVDPPDVVKIQPC
SRLECWIDPSSVSPPKAMELIGSNLQMQYERWQPRARYKKCNDPTVDDVKKLCTSLRRNA
KGERILFHYNGHGVPKPTANGEIWVFNKTFTQYIPLSIFELITWMSAPSIYVYDCSNAGI
IINSFQPYAKQHEEELEKALAAAQQRGGVQQLVGGSGGAANVAANQVQLTNQMVSYKNCI
HLAACAANEILPMNAQLPADLFTSCLTTPINIALKWYAMQEKLGMVPRIQSELIDKIPGK
VNDRRTMMGELNWIFTAITDTIAWNTLPRELFQRLFRQDLLVASLFRNFLLAERILRSHD
CTPVSLPALPPCYRHPMWKAWDLVVDLALQQLPEILDHNAPYRQLPFFEHQLTAFQVWLD
SESESRTPPEQLPIVLQVLLSQVHRLRALELLARFLDLGPWAVNLALGVGIFPYVLKLLQ
SSTRELRPVLVFIWAKILAVDPSCQVDLVKEYKYFLSVLQDTSVSKEHRTLSAFVLSSIV
HNFLLGQTSALQGPLLSICLEQLNDGSWLLRQWLAICLGMLWQNFEKARWSGARDLAHEK
LYVLLRDSIPEVRAAAVFALGTFISSVTDRSEEQANNIDRIIAITMLETVGEDMSPLVRM
ELAAALQWMVVLFESQFVAVYLAEHMRGHVSAASFVMCPDPRDLTSSTHSLERHVTIRRG
ASSSSISNMGGASTSSGTGSSSNPLGRSKSGSGSSGGRGAAGAAGGTNSIPFQSIFTKLW
LGICNLAQDPFPRVAAIAQEIVEHVRDTALCPIMAAKEATMANASEKCSSLSVSLPPSPN
TRVNYLSGGGAPGGAGATAESPPVGAAASGASHWAQKLRLSGSGACMAAGDPQTILQRKL
RTSSINDETDSGPAYSRGVAGAGAGLGLPSGPRESTHSARSSGSESNHYLEPGHSLTPIV
LTEFIPWAISYFTRPGKERYSSAEGSAEEGRQRFPVDRNSTELRRRRLRFLRNDFVRRHA
GRKHQELMDPYGFDVCVWNRKTQFTPSIVKLLPYEPQIAVAYREKVLVYDFQYNSVRTYG
AESVGGNFTGYSSGYGSGSGSSSSLNGSTPRKSGAHTSGGGGFPAAPFARVSSIEFINAQ
DMALNLVAHEDGVVRVWQSSPPASSGTSEDTPSKARLVTAWTALGQVNQHNHRQRSVASG
GSIGKGADASGLSSGAIGSGGIVTAWQQCSQHLVIGGGGCRFIRIWVTRRELKLADIPLG
RSETCARVLSPYLPNMRSDVILAGCDDGSVRLFDKRCPPQDAGISAYRRHSAPILHASLR
GNGLVLVSGCTEGRISVADLRGSQSPINPFDVVYEWDAGADVTAITSHQLEDTVACGNAS
KIVIYSLDGRQQKVLRTNEGFIGPKIGHPTYLYFHPYKAQLAVGFVDNTVAIYSPTPVL
NT seq 4860 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtgccgttcgcgctaagtccgccactgccgcagtcggcgtcgcagtcgacgaa
agcagcggcagcagcaacggcagcgtcggggatcaggatgtggcctccagcaaggaagcc
gtcctgcgctatctaatccgcacgagatacgagcaatatgtattcgcaccgtgggacgat
cccataatcttgataatggagcaactggagcacatcgagcaccgtcgatccgccgccttg
gggaaccaggtggccatcggccgtgacccatctcaggaagactctctgaacgacctgggt
aaggtgattagcaacatgaggcaggaccagtcactggtacctatcgtgaagcacatcgag
caaatatccgacattcaggcctccaacggccaggaactggcctctctcggttctttgagg
gagctgatccagactatcagagaagagtggccccgggacgactctatcaagctgcggctg
aaggaaatacagatcctgggcatgccgcccgtgtggaacttatgcttcggcgagcgtatc
cgcgacgacagatgcccgctctccctgcagaccaagcggcacaaggagcgcattcaggcc
atgatgtacgagcgacagacgtggcgcatccgcgagcgcatgaagacggcaagtgtggcc
ctggttctatgcctcaacatcggcgtggatccgccggacgtggtcaagatccaaccttgc
tcacggcttgagtgctggatagatcccagctcggtgtccccgccaaaggccatggaactc
attgggagcaacctgcagatgcagtacgaacgctggcagccaagggcccggtacaagaag
tgcaacgatcccaccgtggatgacgtgaagaagctctgcacctccctacgccggaacgcc
aagggggagcgcatactcttccactacaacgggcacggagtgcccaagcccacagccaac
ggggagatctgggtgttcaacaagactttcacgcagtacatccccctaagtatattcgag
cttatcacttggatgtcagcgccctccatctacgtgtatgactgctccaacgccgggatc
atcatcaattcgtttcagccatacgctaagcagcacgaggaagaactagagaaggcgctg
gccgccgcccagcagaggggtggtgtccaacagttagtgggcggctctggtggtgccgcc
aatgtagccgccaaccaggtgcagttaaccaaccagatggtcagttacaagaactgtata
cacctggcggcctgtgctgcaaacgaaattcttccgatgaatgcccagctgccggcggat
cttttcaccagctgtctgacaacacccattaacatagcgctcaagtggtacgccatgcaa
gaaaagctgggcatggtaccgcgtattcagagcgaactaatcgacaagattccaggcaag
gtcaacgaccggcgcactatgatgggtgagctcaactggatcttcaccgccattactgac
acgatagcatggaacacacttccccgcgagctctttcagcgcctgtttcgccaggatctg
ctggtggctagcctgtttcgcaatttcctgttggccgagcgcatactgcgcagccacgac
tgcacaccagtttccctgcccgccctgccgccttgctatcgccatccgatgtggaaggcc
tgggatctggtggtagatttggctctacagcagttgccggagatcctcgatcacaatgcg
ccgtaccgccagctgccgttcttcgagcaccagcttacggccttccaggtttggctggac
agcgaatcggagtcgagaacgccaccggaacagctgcccattgtgctgcaggtcctactg
tcgcaggtgcaccgtctgagggccctggagctgctggctcgctttctggatcttggtccg
tgggccgttaatctcgccctgggcgtgggcatctttccatacgtgctcaaactgctacag
agttctacgcgcgaactgcgacccgttttggtgttcatttgggccaagatcctggccgtg
gatcccagctgccaagtggatctggtcaaggaatacaagtacttcctctccgtgctgcag
gacacctccgtttccaaggagcaccgtacactgtccgcctttgtactgtcctccatagtg
cacaacttcctgctgggacagacgagcgcgcttcagggtcccctactgtctatttgcctg
gagcagctgaacgacggaagctggctgctgcgccagtggctagccatctgtctgggcatg
ctgtggcagaactttgagaaggcgcgttggtcgggagcacgcgacctcgcgcacgagaag
ctgtacgttctgctgcgggactcgattccggaagtacgagccgctgccgtcttcgcctta
ggcacgtttattagctccgtgacggatcgtagcgaggagcaggccaataacatcgatcgc
atcattgccattaccatgctcgaaaccgtgggcgaggatatgtcgccgctggtccgcatg
gagctggccgccgccctgcaatggatggtggtgctcttcgagtcacagttcgtggcagta
tatctagctgagcacatgcgcggtcacgtctccgccgcctcgttcgtgatgtgccccgat
ccccgggatctgacgtcttccacgcacagcctggagcgtcatgtgaccatccgcagggga
gctagctccagctccatatccaacatgggtggtgcgtcaacaagctcgggaacaggatca
tccagcaaccctttgggtcgctcgaagagtggctctggcagttcgggcggaagaggagca
gccggagctgcgggcggtactaacagcatacccttccagtcaatctttaccaagctctgg
ctgggcatctgcaatctggcccaggatccgtttcctcgtgtagcggccattgcccaggag
attgttgaacatgtgagggacacggcactgtgtcccatcatggccgccaaggaagcgacc
atggccaatgcctcggagaaatgcagcagcctaagtgtgagcctcccgcccagtccaaat
acaagagttaattacttgagcggtggcggcgcaccaggtggagctggcgcgactgcagaa
tcaccgcccgtcggagcagctgcctcgggcgccagtcactgggcgcaaaagctacgacta
tcaggcagtggagcctgcatggctgctggagatcctcaaaccattctgcagcgcaagctg
cgcacgagctccatcaacgatgagacggacagcggaccagcgtactccagaggagtcgcg
ggcgccggagctggtctgggactgcccagcggaccgagggagagcacccattcggcgcgg
agcagcggcagcgagagcaatcattacctggagccgggacacagcctcacgcctattgtc
ctgaccgaattcataccctgggccatttcctatttcacgcggccaggcaaggagcgctac
agtagcgccgagggatcggcagaggaggggcgccaacgcttcccagtggaccgaaactca
acggagctgcgacgcaggaggttgcgctttctgagaaacgatttcgtgcgccgacatgcc
ggccgaaagcaccaggagctgatggatccgtacggcttcgatgtgtgcgtatggaaccgg
aagacacagttcacgccttccatcgtgaagctgctgccttacgagccgcagattgcagtg
gcctacagggagaaggttctggtgtacgacttccagtacaattcggtacgcacatacggc
gccgagtctgttggcggcaacttcactggctacagttccggttatggatcaggttccgga
tcatcttcatcgcttaacggcagcactccgcgaaagtcgggcgcacatacaagtggagga
ggtggatttcccgccgccccctttgcccgcgttagcagcatcgagtttatcaatgcccag
gatatggcgctcaacttggtggcacacgaagacggagtggtgcgcgtctggcaatcctcg
ccgccggccagctctggcacctccgaggataccccgagcaaggcccgactggtgactgct
tggacagctctgggccaggttaaccaacacaaccaccgtcagcgcagcgtggcttccggc
ggaagcattggcaagggcgcggacgcctcgggattgtcgagcggagcaattggctcggga
ggcattgtgaccgcatggcagcaatgcagccagcacctcgtgataggcggcggtggctgc
cgatttatccgcatttgggtcacgcgaagggaactgaaactggcagatattccattgggt
cgcagcgaaacctgcgcccgggtgctgtcaccctacctgcccaacatgcgttccgatgtg
atcctcgccggctgtgacgacggcagtgtgcgactgtttgacaagcgatgtccgccgcag
gacgccgggatctccgcttatcgacgccacagtgcccccattctccacgccagcctgcgg
ggaaacggactggtgctggtctccggctgcaccgaaggtcggatcagtgtggcggacttg
cgtgggagccagtcccccattaaccccttcgatgttgtgtacgagtgggacgccggtgcc
gacgtgacggccataaccagccaccagttggaggacacggtggcctgcggcaatgcctcc
aagatcgtgatctactcgctggacggacggcagcagaaagtgctgcggacgaacgagggt
ttcattggccccaagatcggtcaccccacgtatctgtattttcacccatacaaagcccag
ctggcggtgggcttcgtggacaatacagtggccatatacagccccaccccagttctataa

DBGET integrated database retrieval system