KEGG   Drosophila simulans: Dsim_GD16311Help
Entry
Dsim_GD16311      CDS       T01065                                 

Gene name
Dsim_EG:EG0007.7
Definition
GD16311 gene product from transcript GD16311-RA
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsim_GD16311 (Dsim_EG:EG0007.7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 542 aa AA seqDB search
MKINHKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHTG
SGALAAIPQTPTGASGSVPPPAGIPNSVAPPGTPSSGGELVNGNNLAAALQKRINRKRKN
HGGSAHGHHSLTSQQQQSHPHPTTPQTPTATPAHVTGDGLISGAANEDGDGSQDGKTPTP
RQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKS
RKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYD
TDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYEL
SKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTDGEKPTITINDICECTSIK
KEDVISTLQNLNLINYYKGQYIVCINRVIIEQHRRAMDKRKIRIDSKCLHWTPKDWSKRS
KW
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaccacaaatatgagttcgacgacgatgtggcctccatatgcgagtcaacg
gccgccctaaccgagggatgtcgtttgcccgtcaggatgcacaaaacggacgactggcca
ctggcggagattgtgagcatcaaggagctggatgggcgccggcagttttacgtgcactat
gtggacttcaacaagcgcttggacgagtgggtcaacgaggaggatctgtacacgcgaaag
gtgcaatttccgcggagggacggctctcaaacaggcaccagcactggagtgaccacaccc
cagcgccaccattccctagcgggcagcgtttctcggcctacatcaccacaacacactggt
tcgggggctctggcagccatcccccagactcctactggtgcatcagggagtgttcctccc
cctgctggcattccgaactctgtggctccaccaggaacacccagcagtgggggagagctt
gtgaatggcaacaatctggccgcagcccttcagaaacgcatcaatcgcaagcgaaaaaac
cacggaggctcggcccatggacaccacagtctgactagtcaacagcagcagtcacatccg
catcctacaactccgcagacacctacggctacgcccgcgcatgtgaccggcgacggtttg
ataagcggagcggccaatgaggatggtgatggatcgcaggatggcaagacgcccacgccg
aggcagtcgggcagcatggttacgcaccaggacgacgtggtcacccgcatgaagaacgtg
gagatgatcgagctgggcagacatcgcattaagccctggtatttctcaccctatccgcaa
gagctgtgtcaaatgccctgcatctacatctgcgagttctgcctgaagtacaggaagagc
aggaagtgcctggagaggcacctgtccaaatgcaatcttaggcatccgccggggaacgag
atctatcgcaagcatacaatttccttctttgaaatcgacggccgcaaaaacaaggtgtat
gcccagaacttgtgcctgcttgccaaactctttctcgaccacaagacactctactatgat
accgatccgtttctcttctacgttatgacagagttcgactcgcgcggctttcacatagta
gggtacttctccaaggagaaggagagcaccgaggactacaacgtggcatgcattctcaca
atgcctccgtatcagcgcaagggctacggcaagctgctcattgagttcagctacgagttg
tccaagtttgagggcaagacgggatcgccggagaaaccattgtctgatctgggtttgctg
tcctatcgatcgtactgggcgcaaaccatactggagatatttatcagccaaaacccgagc
acggacggcgagaagcccaccataactataaacgacatctgcgaatgcacatccatcaaa
aaagaggacgttatctcaacgctgcagaacctgaacctaatcaactactacaagggccag
tacatcgtgtgcatcaaccgggttatcatcgagcagcaccgacgagcaatggacaaacgc
aagatccgcatcgactcaaaatgcctgcactggacacccaaagactggtccaagcgctcc
aaatggtaa

DBGET integrated database retrieval system