KEGG   Drosophila simulans: Dsimw501_GD16466Help
Entry
Dsimw501_GD16466  CDS       T01065                                 

Gene name
Dsim_GD16466
Definition
(RefSeq) GD16466 gene product from transcript GD16466-RD
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
dsi  Drosophila simulans
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dsimw501_GD16466 (Dsim_GD16466)
Enzymes [BR:dsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dsimw501_GD16466 (Dsim_GD16466)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dsimw501_GD16466 (Dsim_GD16466)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 1300 aa AA seqDB search
MVVGSNHTRRGETGSRFTNSSSSSSSNGGPTASASSTTSVTSSLATNSTSTSTAAALLSS
MSQKSHGPPPSAPPSNQTNQQHHQVAHSQPHATHYQQTNQHPSHHHQSHQSSNGSGGGSA
GSGSGSGSVVSGLNGCNGSAVSRLSQSTGMSPRELSENDDLATSLILDPHLGFQTHKMNI
RFRPLKVDTQQLKAIVDDFIHTQNYDIAIQRIYEGPWIPRHLKNKNKIATKRLHDHIVRY
LRVFDKDSGFAIEACYRYTLEEQRGAKISSTKRWSKNDKIECLVGCIAELTEAEEAALLH
SGKNDFSVMYSCRKNCAQLWLGPAAYINHDCRANCKFLATGRDTACVKVLRDIEVGEEIT
CFYGEDFFGDSNRYCECETCERRGTGAFAGKDDGLMLGLSMGLGLASSGPGNNGGYRLRE
TDNRINRIKSRANSTNSTSNSNSNTNDSTGPSETSSTNGLVASGGAAGAGGGTGGAMLSI
PSQQSTVGKEATAAVSLLEKKLPNVVVSPLTMKELRQKGMTKYDAEMIMANAAYQQQHHH
QHHFHHHHHHLHHHHNHGQHASTGAEATAAVQQMAAMQKPGVGGTGAAGNAGATTVSSVA
AGAGSEVNGGRSTSLRKSIRVNSTSSSISTASADEVIAPVVAASIPLPTKAPVVLMPRCK
PAQMAIAALHQSQQRQLRRSERQKEKLTDGESSDTSSEQQKKEQKEQDHQLPQKMFSLAE
EPQPEKPEEKQQEQQKRVTRNSAGRVGLVARLATAHNNNIATTTNSSSSSNKATTITNCN
NHNSNNSSRINHNSNLSGRLSVKSRKPTPSEASSIPSSTSSENQQQQATRRSCSPTPAYK
KNLLASFDPDPPSTQGIKEQLKDESVTYSPVKQKRSRRAAALAAAQSIHCEALGGFPTGS
TGGHRKRAQAGEPAISCSSTTISNVQPLLKTPERRLKLTLRMKRSPILDEVIELGTSLSN
GAAGRGAAGSHREGTAGEGSARGALNLTAGSSNGIEYEILRMEGISEHGNDDDEDEEEED
EEPAAEEEEPPPKEELQLVTKKQRKKQRSRSRSSQRRSPAPSSVYGTPQKKRLRLIFGNE
SHTIDIPPAAAEGSGSGLDDLNSSGGGGDESFNASYASSTSLTVNTSSSSTNSSGGVGGA
TSTSAEPVDSSTVGPPIAAQSPSSTTSSSFQSACTSTTNSNSYFPNGKQRAAGEDSYAMH
YYQLGKFTGTPSPGQGQAIVSSSSGSSGGGGSGAGFLSMPKHTFGTCALLAPTSFACLQN
QPQICQQKTSSGGGAGVVPTSTSTGAVTSYHHTNNHHGQK
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcggctctaatcacacgcggcgcggtgaaactggcagcagatttacaaacagc
agcagctctagcagctcaaacggtggccccaccgcttcggccagcagcaccaccagcgta
acgtcttcactagccaccaattccacgtcaacatcgacggctgcggctctgttgtcgtcc
atgtcccagaagagccatggccctccgccatccgcacctccatcgaaccagacgaaccag
cagcatcatcaggtggcccacagccagccacatgccacccattaccaacagacaaaccag
caccctagccaccatcaccagtcccatcagtcttcgaacggcagtggcggaggatctgct
ggatcaggatccggatctggatcggtggttagtggactcaatggttgcaacggcagcgcc
gtcagtcgcctatcgcaatccactgggatgtcgccgcgggaactgtccgagaacgatgac
ctggccacatcgctgattctcgatccccatcttggtttccagacccacaagatgaacata
cgctttcggccccttaaggtggacacgcagcaactaaaggcgatcgtggacgattttatc
cacacgcagaattacgatatagccatccagcgcatctacgaagggccgtggataccgcgc
catctcaagaacaagaacaagattgccaccaagcggctccacgatcatatcgtccgatac
ttgcgcgtctttgacaaggacagcgggtttgcaatcgaggcctgctacagatacacactg
gaagagcaacgtggcgccaagattagctcgacgaagcggtggtcgaagaacgacaagatc
gaatgcctggtgggttgcatcgccgagctgacggaggcggaggaggctgctctgctgcac
tctggcaaaaatgacttctcagtaatgtatagttgtcgcaagaattgcgcccaattgtgg
ctgggaccggctgcctatatcaaccacgattgtcgcgccaactgcaagtttttagccacc
ggcagggacacagcgtgtgtaaaggtcctgcgcgacattgaggttggggaggagataacc
tgcttctacggcgaggacttctttggggattctaatcgctattgtgagtgcgaaacgtgc
gaacgccgtgggactggagccttcgccgggaaggatgatggcctgatgctgggactcagt
atgggactcggcttggctagcagtggacctggtaataatggtggctatcgtctgagggag
actgacaatcggattaaccgcatcaagagccgagccaactccacaaacagcacctcaaac
agcaacagtaatacaaatgattccactggccccagcgagactagcagcacaaatggattg
gtggcttctggcggagcagctggagcaggaggaggcactggtggcgcgatgctgtccata
ccttcgcaacaatcaactgtcggcaaagaggccacagccgccgtctctttgctcgaaaag
aaacttccgaatgttgttgtttcaccgctgaccatgaaggagctccgacaaaagggaatg
actaagtacgatgccgagatgatcatggccaacgcagcttatcagcagcagcaccatcat
cagcatcatttccatcaccaccatcatcatcttcaccatcaccacaatcatggccagcat
gcaagtactggagccgaggccacagcggctgtacagcaaatggcagccatgcagaaacca
ggagttggtggaacaggagctgcaggaaatgctggagcaacaacagtgagcagcgtggcc
gccggagcgggctccgaggttaatggtggtcgttccaccagtctgcgcaagtctatacga
gttaacagcaccagcagcagcatttccaccgcctccgcggacgaggtgatcgcgcccgtg
gtcgcggcgagcattccgctaccaaccaaggcaccggtggttcttatgccgcgttgcaag
cccgcccagatggccattgccgcgctgcaccagagccagcagcgccagcttagacgtagc
gaacgccagaaggaaaagctgacggacggtgagagcagcgacaccagcagcgagcagcaa
aagaaagagcagaaggagcaggatcaccaactgccgcaaaaaatgttcagcctggcggag
gaaccacaaccagagaagccggaggagaagcaacaggagcagcagaagcgtgtgacgcga
aatagtgcgggaagagtaggattggtagcaagattagccactgcccataacaataacatt
gcaaccacaacaaatagcagcagcagcagcaacaaagcaacaacgattacaaattgtaat
aatcataatagtaataatagcagtagaattaatcataattcaaatcttagcggtagactt
agtgttaaatcgaggaagccaacaccaagtgaggcctcgtccataccctcatccacatca
tcagaaaatcagcagcagcaggcaacgcgtcgcagctgcagcccgactcccgcctacaag
aagaaccttttggccagcttcgatcccgatcctccctccacccaaggaatcaaggagcag
ctaaaggacgaatcagttacttattcgccggtcaagcagaaacgtagcagaagggccgct
gctctggcggcagcgcaaagtatccactgcgaagcgttgggcggattccctaccggttct
actggtggccaccgcaagagggcccaggccggagaacctgccatctcatgctcctcaaca
accattagcaatgttcagcccctactgaagactccagagcgcaggctgaagctaacgttg
cgcatgaaacgctcaccaatcctagacgaagtaattgagctcggaacgagtctgagcaac
ggagcagctggtcgaggtgcagctggctcccatcgggaagggacagcaggagaggggtca
gctagaggtgcgctaaacctaaccgccggcagctcaaatggtattgaatacgagatactg
cgcatggagggtatttcagagcacggcaacgatgacgatgaggacgaggaagaagaggat
gaagagccagctgccgaagaagaggagccgccgccgaaggaggagctgcagctggtcacc
aagaagcagagaaagaaacagcgcagccggagcaggagcagccaacgcagatcgccggcg
ccaagcagtgtatatggaacaccgcagaagaagcgactccgcttgatctttggtaacgaa
tcccacaccatagacattccaccagcagcagcagagggatcgggcagcggcttggatgac
ctaaacagcagtggaggcggtggcgacgagtcctttaatgcctcctacgccagcagcacc
agtttgacggttaatacatcctcaagcagtaccaactcatccggtggagtgggaggagct
acctccacctctgcagagccagtggattcttccacagtgggaccgcccattgctgcccaa
tcaccctcatcgacgaccagcagctcctttcaatcagcctgcacatcgaccaccaacagc
aacagctactttcccaatggcaagcaacgagctgctggcgaggactcctatgcgatgcac
tactaccagctgggcaaatttactggaaccccaagtccgggacagggtcaggccatcgtg
agcagcagcagtggttcgtcaggaggaggaggatctggagctggcttcctgagcatgccc
aaacacacattcggcacctgtgctttgctggcccccaccagtttcgcctgcctgcagaat
cagccgcagatttgccagcagaagaccagcagcggcggaggagcaggagtggtgcccacc
tccacttcaacgggcgcagtcacatcttaccatcatacaaacaatcatcacggccagaaa
taa

DBGET integrated database retrieval system