KEGG   Drosophila simulans: Dsim_GD16466Help
Entry
Dsim_GD16466      CDS       T01065                                 

Definition
GD16466 gene product from transcript GD16466-RA
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
dsi  Drosophila simulans
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dsi00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1021 aa AA seqDB search
MECLVGCIAELTEAEEAALLHSGKNDFSVMYSCRKNCAQLWLGPAAYINHDCRANCKFLA
TGRDTACVKVLRDIEVGEEITCFYGEDFFGDSNRYCECETCERRGTGAFAGKDDGLMLGL
SMGLGLASSGPGNNGGYRLRETDNRINRIKSRANSTNSTSNSNSNTNDSTGPSETSSTNG
LVASGGAAGAGGGTGGAMLSIPSQQSTVGKEATAAVSLLEKKLPNVVVSPLTMKELRQKG
MTKYDAEMIMANAAYQQQHHHQHHFHHHHHHLHHHHNHGQHASTGAEATAAVQQMAAMQK
PGVGGTGAAGNAGATTVSSVAAGAGSEVNGGRSTSLRKSIRVNSTSSSISTASADEVIAP
VVAASIPLPTKAPVVLMPRCKPAQMAIAALHQSQQRQLRRSERQKEKLTDGESSDTSSEQ
QKKEQKEQDHQLPQKMFSLAEEPQPEKPEEKQQEQQKRVTRNSAGRVGLVARLATAHNNN
IATTTNSSSSSNKATTITNCNNHNSNNSSRINHNSNLSGRLSVKSRKPTPSEASSIPSST
SSENQQQQATRRSCSPTPAYKKNLLASFDPDPPSTQGIKEQLKDESVTYSPVKQKRSRRA
AALAAAQSIHCEALGGFPTGSTGGHRKRAQAGEPAISCSSTTISNVQPLLKTPERRLKLT
LRMKRSPILDEVIELGTSLSNGAAGRGAAGSHREGTAGEGSARGALNLTAGSSNGIEYEI
LRMEGISEHGNDDDEDEEEEDEEPAAEEEEPPPKEELQLVTKKQRKKQRSRSRSSQRRSP
APSSVYGTPQKKRLRLIFGNESHTIDIPPAAAEGSGSGLDDLNSSGGGGDESFNASYASS
TSLTVNTSSSSTNSSGGVGGATSTSAEPVDSSTVGPPIAAQSPSSTTSSSFQSACTSTTN
SNSYFPNGKQRAAGEDSYAMHYYQLGKFTGTPSPGQGQAIVSSSSGSSGGGGSGAGFLSM
PKHTFGTCALLAPTSFACLQNQPQICQQKTSSGGGAGVVPTSTSTGAVTSYHHTNNHHGQ
K
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcctggtgggttgcatcgccgagctgacggaggcggaggaggctgctctgctg
cactctggcaaaaatgacttctcagtaatgtatagttgtcgcaagaattgcgcccaattg
tggctgggaccggctgcctatatcaaccacgattgtcgcgccaactgcaagtttttagcc
accggcagggacacagcgtgtgtaaaggtcctgcgcgacattgaggttggggaggagata
acctgcttctacggcgaggacttctttggggattctaatcgctattgtgagtgcgaaacg
tgcgaacgccgtgggactggagccttcgccgggaaggatgatggcctgatgctgggactc
agtatgggactcggcttggctagcagtggacctggtaataatggtggctatcgtctgagg
gagactgacaatcggattaaccgcatcaagagccgagccaactccacaaacagcacctca
aacagcaacagtaatacaaatgattccactggccccagcgagactagcagcacaaatgga
ttggtggcttctggcggagcagctggagcaggaggaggcactggtggcgcgatgctgtcc
ataccttcgcaacaatcaactgtcggcaaagaggccacagccgccgtctctttgctcgaa
aagaaacttccgaatgttgttgtttcaccgctgaccatgaaggagctccgacaaaaggga
atgactaagtacgatgccgagatgatcatggccaacgcagcttatcagcagcagcaccat
catcagcatcatttccatcaccaccatcatcatcttcaccatcaccacaatcatggccag
catgcaagtactggagccgaggccacagcggctgtacagcaaatggcagccatgcagaaa
ccaggagttggtggaacaggagctgcaggaaatgctggagcaacaacagtgagcagcgtg
gccgccggagcgggctccgaggttaatggtggtcgttccaccagtctgcgcaagtctata
cgagttaacagcaccagcagcagcatttccaccgcctccgcggacgaggtgatcgcgccc
gtggtcgcggcgagcattccgctaccaaccaaggcaccggtggttcttatgccgcgttgc
aagcccgcccagatggccattgccgcgctgcaccagagccagcagcgccagcttagacgt
agcgaacgccagaaggaaaagctgacggacggtgagagcagcgacaccagcagcgagcag
caaaagaaagagcagaaggagcaggatcaccaactgccgcaaaaaatgttcagcctggcg
gaggaaccacaaccagagaagccggaggagaagcaacaggagcagcagaagcgtgtgacg
cgaaatagtgcgggaagagtaggattggtagcaagattagccactgcccataacaataac
attgcaaccacaacaaatagcagcagcagcagcaacaaagcaacaacgattacaaattgt
aataatcataatagtaataatagcagtagaattaatcataattcaaatcttagcggtaga
cttagtgttaaatcgaggaagccaacaccaagtgaggcctcgtccataccctcatccaca
tcatcagaaaatcagcagcagcaggcaacgcgtcgcagctgcagcccgactcccgcctac
aagaagaaccttttggccagcttcgatcccgatcctccctccacccaaggaatcaaggag
cagctaaaggacgaatcagttacttattcgccggtcaagcagaaacgtagcagaagggcc
gctgctctggcggcagcgcaaagtatccactgcgaagcgttgggcggattccctaccggt
tctactggtggccaccgcaagagggcccaggccggagaacctgccatctcatgctcctca
acaaccattagcaatgttcagcccctactgaagactccagagcgcaggctgaagctaacg
ttgcgcatgaaacgctcaccaatcctagacgaagtaattgagctcggaacgagtctgagc
aacggagcagctggtcgaggtgcagctggctcccatcgggaagggacagcaggagagggg
tcagctagaggtgcgctaaacctaaccgccggcagctcaaatggtattgaatacgagata
ctgcgcatggagggtatttcagagcacggcaacgatgacgatgaggacgaggaagaagag
gatgaagagccagctgccgaagaagaggagccgccgccgaaggaggagctgcagctggtc
accaagaagcagagaaagaaacagcgcagccggagcaggagcagccaacgcagatcgccg
gcgccaagcagtgtatatggaacaccgcagaagaagcgactccgcttgatctttggtaac
gaatcccacaccatagacattccaccagcagcagcagagggatcgggcagcggcttggat
gacctaaacagcagtggaggcggtggcgacgagtcctttaatgcctcctacgccagcagc
accagtttgacggttaatacatcctcaagcagtaccaactcatccggtggagtgggagga
gctacctccacctctgcagagccagtggattcttccacagtgggaccgcccattgctgcc
caatcaccctcatcgacgaccagcagctcctttcaatcagcctgcacatcgaccaccaac
agcaacagctactttcccaatggcaagcaacgagctgctggcgaggactcctatgcgatg
cactactaccagctgggcaaatttactggaaccccaagtccgggacagggtcaggccatc
gtgagcagcagcagtggttcgtcaggaggaggaggatctggagctggcttcctgagcatg
cccaaacacacattcggcacctgtgctttgctggcccccaccagtttcgcctgcctgcag
aatcagccgcagatttgccagcagaagaccagcagcggcggaggagcaggagtggtgccc
acctccacttcaacgggcgcagtcacatcttaccatcatacaaacaatcatcacggccag
aaataa

DBGET integrated database retrieval system