KEGG   Drosophila simulans: Dsim_GD16510Help
Entry
Dsim_GD16510      CDS       T01065                                 

Definition
GD16510 gene product from transcript GD16510-RA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dsi  Drosophila simulans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dsim_GD16510
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dsim_GD16510
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dsim_GD16510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 351 aa AA seqDB search
MWWSRKFVSRSLRLHRLKSTRSTAPRKPEQSLGIIGVPFAKGQGKQGVELAPDLLRQSSL
RQVLQSSHDDLVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLV
ENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLL
EQLRNTWQHAGLQEIAPNCLPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVP
KIIEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTERVQ
GVDLVEINPKLGSERDVRTTVESGLEILKSMFGYRRSGRWSNIDTGILGSD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagccgtaaatttgtctcaaggtctctccgcctccaccggctcaagagcacc
agaagcactgcgcccaggaaaccggagcaatctctaggcatcattggagtgcccttcgca
aaggggcagggcaagcagggcgtggaactggcgccagatcttctccggcagagcagtctg
cgtcaggtgcttcagagcagtcatgatgacctggtgatacgggactacggaaatctgcag
tacgccgtagacgagccccttctccagcagcagcgtgtgcactatcaccacatcagaaac
tacgcggacttcatggcctgcaatcgggcactgattgaacaggtgaaactcatgctcgtg
gaaaacacgcagtttttggccattggtggggatcatgcgatcggcttcggatccgtggcc
gggcacctgcaacatacgccgaatttgtccctggtgtggatcgacgcacatgcggacatc
aatctgcatagcacctcgcagtcgggcaacatccatgggatgcccgtatcatttctgttg
gagcagctccgtaacacctggcagcacgctggcctccaggaaatcgcgcccaactgcttg
cccaaggatcagctggtttacatcggactccgggacattgacccctacgaggctttcatc
ctaaacaaagtcggaatacgctactatgcaatggataccatcgaccgggtgggcgtgccc
aagattatcgagatgacgctggacgcccttaatccgcagaacaagatccacgtcagcttt
gacatcgacgccttggacagcaatgtggcgcctagcacgggcaccgcggtacgcggtggc
ctcacgctccgcgagggaatcagcatcgtggaggcactccgggacactgagcgggtgcag
ggcgtcgatctggtggagatcaacccaaagctaggcagcgagcgcgacgtgcgcaccact
gtggagtccggcctggagatactgaagagcatgttcggttaccggcgttccgggcgctgg
agcaacatcgatactggaatccttggcagcgattaa

DBGET integrated database retrieval system