KEGG   Drosophila simulans: Dsimw501_GD16516Help
Entry
Dsimw501_GD16516  CDS       T01065                                 

Gene name
Dsim_GD16516
Definition
(RefSeq) GD16516 gene product from transcript GD16516-RA (EC:2.7.1.15)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
dsi  Drosophila simulans
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dsimw501_GD16516 (Dsim_GD16516)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dsimw501_GD16516 (Dsim_GD16516)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 304 aa AA seqDB search
MAETEVLVFGSAIIDFISYTTRLPKAGETLHGHRFQTGYGGKGANQCVAAARQGSRTALV
AKLGADTFGSDYLRHLREEHVNVNHVEQLAEQTTGVAQIAVSDGGENNIIIVVGANNQLS
SCDVSSAEALFQEAKVLVCQLETPVEATLTALRTFRGVSIVNAAPAMTDTPPELLQLASI
FCVNESEAALMTQMPDICNVEQAEDAVGKLIAAGANTVIITLGKLGAVFGSADSKGVCQH
VAAPSVAPEKVVDTTGAGDAFIGALAHHLARHPKGKLEEHIAAACAVASQSVQLPGTQSS
FPRA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaacggaagtgctggtattcggctcggccatcattgactttataagctatacg
acccgtctgccgaaagccggagaaacgctccatgggcatcgcttccagactggctacggc
ggcaagggcgccaatcagtgtgtggctgccgcgcgccaaggatcccgcacagctctggtg
gccaaactgggcgcagacaccttcggaagcgactatctgcggcatctgcgcgaggagcac
gtcaatgtcaaccacgtcgagcagctggcggagcagacgactggcgtggcccagatagcc
gtgtcagatggcggcgagaacaacatcatcattgtggtgggcgccaacaatcagctgagc
tcgtgtgacgtttcctcggcggaggcgctcttccaggaagccaaagttctggtgtgccag
ctggagacgccggttgaggccaccctgaccgctctgagaaccttccggggcgtgtccatt
gtcaacgcggctccggccatgaccgacacaccccccgaactgctccagttggccagcatc
ttctgtgtgaacgaaagcgaggcggctttgatgactcagatgcccgacatttgcaacgta
gagcaagccgaagatgcggttggaaagctgatagcggcaggtgccaacacggtgatcata
actctgggcaaactaggagctgtattcggctccgccgactccaagggcgtgtgccagcat
gtggctgcgccaagtgtggcgcccgaaaaagtggtggacacgacgggggctggcgacgcc
ttcattggggccttggcccaccacttggcccgtcatccaaaagggaaactggaggagcac
atagctgccgcctgtgccgtggcctcgcaatccgtccagctacctgggacgcagtcgagc
ttcccacgcgcttag

DBGET integrated database retrieval system