KEGG   Drosophila simulans: Dsim_GD16516Help
Entry
Dsim_GD16516      CDS       T01065                                 

Definition
GD16516 gene product from transcript GD16516-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dsi  Drosophila simulans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dsim_GD16516
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dsim_GD16516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 317 aa AA seqDB search
MAETEVLVFGSAIIDFISYTTRLPKAGETLHGHRFQTGYGGKGANQCVAAARQGSRTALV
AKLGADTFGSDYLRHLREEHVNVNHVEQLAEQTTGVAQIAVSDGGENNIIIVVGANNQLS
SCDVSSAEALFQEAKVLVCQLETPVEATLTALRTFRGVSIVNAAPAMTDTPPELLQLASI
FCVNESEAALMTQMPDICNVEQAEDAVGKLIAAGANTVIITLGKLGAVFGSADSKGVCQH
VAAPSVAPQKSGGHDGGLATPSLGALAHHLARHPKGKTGGAHSCRLCRGLAIRPATWDAV
ELPTRLEGNPRENVSQQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaacggaagtgctggtattcggctcggccatcattgactttataagctatacg
acccgtctgccgaaagccggagaaacgctccatgggcatcgcttccagactggctacggc
ggcaagggcgccaatcagtgtgtggctgccgcgcgccaaggatcccgcacagctctggtg
gccaaactgggcgcagacaccttcggaagcgactatctgcggcatctgcgcgaggagcac
gtcaatgtcaaccacgtcgagcagctggcggagcagacgactggcgtggcccagatagcc
gtgtcagatggcggcgagaacaacatcatcattgtggtgggcgccaacaatcagctgagc
tcgtgtgacgtttcctcggcggaggcgctcttccaggaagccaaagttctggtgtgccag
ctggagacgccggttgaggccaccctgaccgctctgagaaccttccggggcgtgtccatt
gtcaacgcggctccggccatgaccgacacaccccccgaactgctccagttggccagcatc
ttctgtgtgaacgaaagcgaggcggctttgatgactcagatgcccgacatttgcaacgta
gagcaagccgaagatgcggttggaaagctgatagcggcaggtgccaacacggtgatcata
actctgggcaaactaggagctgtattcggctccgccgactccaagggcgtgtgccagcat
gtggctgcgccaagtgtggcgccccaaaaaagtggtggacacgacggggggctggcgacg
ccttcattgggggccttggcccaccacttggcccgtcatccaaaagggaaaactggagga
gcacatagctgccgcctgtgccgtggcctcgcaatccgtccagctacctgggacgcagtc
gagcttcccacgcgcttagagggaaatccccgagagaatgtgtcgcaacaataa

DBGET integrated database retrieval system