KEGG   Drosophila simulans: Dsim_GD16529Help
Entry
Dsim_GD16529      CDS       T01065                                 

Definition
GD16529 gene product from transcript GD16529-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dsi  Drosophila simulans
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dsim_GD16529
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Dsim_GD16529
Glycosyltransferases [BR:dsi01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dsim_GD16529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 765 aa AA seqDB search
MAASVVKTPKCPRRGSVKDVAQSAHRSGPTSSKEANWNWWLLLATVFLVTFATRFYKVTE
PDHICWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNE
TRYQGMRYFCTTLGALIMPMGFDTVYDLTRSHEAALLAAAYLIFDVGLLTLNQYILLDPI
LLFFMMASVWGMVKVSKSTASGGSYGLRWWFWLFLTGTMLSCTISVKFVGLFVVLLVGLH
TATELWLILGDLGQPILETVKQLACRAITLIVWPILLYILFFYIHLCVLNRSGNGDGFYS
SAFQSRLIGNSLYNASMPRDVAYGSLVTIKNHKTGGGYLHSHHHLYPKGLGARQQQVTTY
THKDENNRWLIRPHNKKGLPKGKPQILRHGDLVRLTHMATRRNLHSHNEPAPMTKKHLQV
TGYGELGVGDANDAWRVLIVGGKVNETVHTVTTRLKFIHLLQNCALTSSGKQLPKWGFEQ
QEVSCNPNVRDKNSQWNVEDNEHKLMPSVSFSVYAPGFFARFLESHAVMLQGNAGLKPKE
GEVTSRLWQWPINYRSQFFSGSSYRIYLLGNPLIWWSNLVFLALFVTVFLWNAVVQQRRA
GFARSTAQNQAQSPDSETVAQGEESEHSTMDICSCCTPVKEKVPKAVPSGSPEAPNPAQS
LRAAAWLFLGWMLHYLPFWAMGRVLYFHHYFPALIFNSLLTGVMFNYIMRVLPKWIHHAI
LGLVLSILVYSFAAFSPLAYGMSGPLANEPNSTMHNLKWLSTWEF
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagtgttgttaaaacccccaagtgccccagacgaggatctgtcaaagatgtg
gcccaaagcgcacatagatcagggcccacatctagcaaagaggccaattggaactggtgg
cttctcctggccaccgtcttcctggtgaccttcgccacacgcttctataaggtcaccgaa
ccggatcacatatgttgggatgagacgcattttggcaagatgggcagttggtacatcaac
agaactttttttttcgatgtccatccaccgctgggaaagatgctcattggcctctctggc
tacttgacgggctacaatggaacgtttccgtttgagaagccaggcgacaagtacaacgaa
acgcggtaccagggcatgcgatatttctgcaccacactgggagctctgatcatgcccatg
ggattcgatactgtctacgatttgacccgttcccatgaagctgctttgcttgcggctgcc
tatcttattttcgatgtggggctcttgaccctcaaccagtacatcctgctggaccctatc
ttactattcttcatgatggcctccgtctggggcatggtcaaggtatcgaagtccacggcc
tccggaggatcgtacggtctgcgctggtggttctggctcttcctcaccgggaccatgttg
tcctgcacgattagcgttaagttcgtgggtctgtttgtggtgctgttggtcggtctgcat
acagccactgaactgtggctcatcctcggcgatttggggcagcccattctggagactgtt
aagcagttggcctgccgggccatcaccctgattgtctggcccattctcctttatatcctg
ttcttctacattcacctctgtgtccttaaccgcagcggcaacggagatgggttctatagt
tcggcctttcagtccaggctgatcggcaactccctatataatgccagcatgcccagagat
gtggcctacggatctctggtgaccattaagaaccacaagacgggcggaggctacctgcat
tcgcatcatcacctgtatcccaagggattgggcgccaggcagcagcaggtcaccacttac
acccacaaggacgagaacaataggtggctaatcaggccgcacaacaagaagggtctacca
aagggcaagccccagatcctccggcacggggaccttgtccgcctgactcacatggcgacc
aggagaaatctgcactcccacaacgaacctgcgcccatgaccaagaagcatttacaggtc
actggctatggcgagttgggcgtaggcgatgccaacgacgcatggcgcgtgttgattgtg
ggcggcaaggtcaacgaaacggtacacacggtcaccacccgtctcaagttcatccacctg
ctacagaactgcgccctgacctccagtgggaagcagttaccgaaatgggggttcgagcag
caagaggtgtcctgcaatcccaacgtgcgcgacaagaactcgcagtggaacgtcgaggac
aacgagcacaagttgatgcccagtgtgagctttagcgtgtatgcgcccggcttctttgcc
cgcttcctcgaatcccacgccgttatgcttcagggaaacgcaggactcaagcccaaagag
ggcgaggtcaccagcagactctggcagtggccgatcaactacaggagccagttcttctcc
ggcagcagttaccgcatctacttgctgggaaacccgttgatttggtggagcaatctggtt
ttcctggcccttttcgtcactgttttcctgtggaacgcagtcgttcagcaaagaagagct
ggcttcgcccgatcgacggcccaaaatcaagcccaaagtcccgattcggagacagtggcc
cagggagaggagagtgagcactccaccatggacatctgcagttgctgtactccggtgaag
gagaaagtcccaaaggcagttcctagtgggtccccggaggcacccaacccggcgcagtct
ttacgggcggccgcctggctttttctgggctggatgctccactatctgcccttctgggcg
atgggacgggtgctctacttccaccactattttccggccttgatcttcaactccttgctg
acgggcgttatgttcaactacattatgagagttctgcccaaatggattcaccacgctatc
ctgggactggttctctcgatcctggtctatagttttgccgccttctcgccacttgcttac
ggaatgagtggtcctctagccaacgagcccaactctacaatgcataatctcaagtggctt
tctacctgggagttctag

DBGET integrated database retrieval system