KEGG   Drosophila simulans: Dsim_GD16554Help
Entry
Dsim_GD16554      CDS       T01065                                 

Definition
GD16554 gene product from transcript GD16554-RA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dsi04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dsi04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:dsi04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 582 aa AA seqDB search
MPQMRAAAAEAVAAGSANGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILN
RQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS
GIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVI
DTYAVAEVCTKFGVKETEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFF
VAGSPPPPPPPPVPQSSMDHQAPLATVTVGGGTSASSGTATPVPPVAGGTPSSTIPIRPH
PERIAPMRDRQLAMSVQTSGGGAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRA
MKALSYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNDEVEQGDD
VIMESLTPPPLSVSGVMPLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgccccagatgagggctgcggccgctgaggcggtggccgccggcagcgccaatggccag
ccgctagtcaagatcgggcactacctactgggcgccaccctgggcacgggcaccttcggc
aaggtgaagatcggcgagcaccagatcacacgcgtcaaggtggccgtcaagatactcaat
cggcagaagatcaagagcctggatgtcgtgggcaagatccggcgtgaaatccaaaaccta
aagctcttccgccatccgcacatcatcaagctgtaccaggtcatatcgacgccgtcggac
atcttcatgatcatggagtacgtgagcggcggggagctgttcgactatattgtgaagcac
ggcaagctgcaggagcaccaagcgcgccgcttctttcagcagattatttctggcgtggat
tattgccaccggcacatgatcgtgcatcgggacctgaagccagagaacctgctgctcgac
cacaacatgcacgtgaagatcgccgacttcgggctctcgaacatgatgctggacggcgag
ttcctgcgcacctcgtgcggctcgcccaactacgctgcccccgaggtgatttccggcaag
ctttacgccgggccagaggtggacatctggtcgtgcggcgtcatcctgtacgccctgctg
tgcgggacgctgccctttgacgatgagcacgtgcccacgctgttccgcaagatcaagtcg
ggcattttccccattcccgagtacctcaacaaacaagtggtcaatctggtgtgccagatg
ctgcaagtggacccgctcaagcgggccaacatcgaggagatcaagaagcacgagtggttc
caaaaggacctcccggcctacctcttcccctcgtccatcgagcaggactccaatgtgatc
gacacctacgctgtggcagaggtctgcaccaagttcggcgtcaaggagaccgaggtgcac
aactcgctgctcagcggcgatccgcacgatcagctggccatcgcttaccatctgatcatc
gacaacaaacgcttcgccgacgacgcggccaaccaaataaacgagatcaacaacttcttt
gtggccggctctccaccaccgccgccgcctccgcccgttccccaatcatcgatggaccac
caagcccctctggccaccgtgaccgtgggcggaggcacctcagccagctcgggcaccgcc
acaccagtgccaccagtggctggaggcacgcctagcagcaccatccccattcgaccgcat
ccggagcggattgcgccgatgcgggaccgtcaactggccatgtccgtgcagacatctggc
ggcggagccttcccggagaaaaccgcacgtggcggcactcccatcaagcgcgccaagtgg
catctgggcatccggtcgcagagcaagcccaacgacataatgctcgaggtataccgagcg
atgaaggcactcagctacgagtggaagatcattaatccataccacgttcgagtgcgcagg
cagaacgtgaagaccggcaagttctcgaagatgtcactgcagctgtaccaggtggacgcc
aagagctatctgctcgacttcaagtcgctgactaacgacgaggtcgagcagggcgacgac
gtcatcatggagagccttactccgccgccgcttagcgtgtccggggtgatgccgctgcag
ccgaccgggcaccacaccatggagtttttcgaaatgtgcgccgccctgatcattcaactg
gctcgctga

DBGET integrated database retrieval system