KEGG   Drosophila simulans: Dsim_GD16554Help
Entry
Dsim_GD16554      CDS       T01065                                 

Definition
GD16554 gene product from transcript GD16554-RA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsim_GD16554
   04150 mTOR signaling pathway
    Dsim_GD16554
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dsim_GD16554
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dsim_GD16554
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dsim_GD16554
Mitochondrial biogenesis [BR:dsi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dsim_GD16554
  Mitophagy factors
   Other mitophagy factors
    Dsim_GD16554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 582 aa AA seqDB search
MPQMRAAAAEAVAAGSANGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILN
RQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS
GIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVI
DTYAVAEVCTKFGVKETEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFF
VAGSPPPPPPPPVPQSSMDHQAPLATVTVGGGTSASSGTATPVPPVAGGTPSSTIPIRPH
PERIAPMRDRQLAMSVQTSGGGAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRA
MKALSYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNDEVEQGDD
VIMESLTPPPLSVSGVMPLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgccccagatgagggctgcggccgctgaggcggtggccgccggcagcgccaatggccag
ccgctagtcaagatcgggcactacctactgggcgccaccctgggcacgggcaccttcggc
aaggtgaagatcggcgagcaccagatcacacgcgtcaaggtggccgtcaagatactcaat
cggcagaagatcaagagcctggatgtcgtgggcaagatccggcgtgaaatccaaaaccta
aagctcttccgccatccgcacatcatcaagctgtaccaggtcatatcgacgccgtcggac
atcttcatgatcatggagtacgtgagcggcggggagctgttcgactatattgtgaagcac
ggcaagctgcaggagcaccaagcgcgccgcttctttcagcagattatttctggcgtggat
tattgccaccggcacatgatcgtgcatcgggacctgaagccagagaacctgctgctcgac
cacaacatgcacgtgaagatcgccgacttcgggctctcgaacatgatgctggacggcgag
ttcctgcgcacctcgtgcggctcgcccaactacgctgcccccgaggtgatttccggcaag
ctttacgccgggccagaggtggacatctggtcgtgcggcgtcatcctgtacgccctgctg
tgcgggacgctgccctttgacgatgagcacgtgcccacgctgttccgcaagatcaagtcg
ggcattttccccattcccgagtacctcaacaaacaagtggtcaatctggtgtgccagatg
ctgcaagtggacccgctcaagcgggccaacatcgaggagatcaagaagcacgagtggttc
caaaaggacctcccggcctacctcttcccctcgtccatcgagcaggactccaatgtgatc
gacacctacgctgtggcagaggtctgcaccaagttcggcgtcaaggagaccgaggtgcac
aactcgctgctcagcggcgatccgcacgatcagctggccatcgcttaccatctgatcatc
gacaacaaacgcttcgccgacgacgcggccaaccaaataaacgagatcaacaacttcttt
gtggccggctctccaccaccgccgccgcctccgcccgttccccaatcatcgatggaccac
caagcccctctggccaccgtgaccgtgggcggaggcacctcagccagctcgggcaccgcc
acaccagtgccaccagtggctggaggcacgcctagcagcaccatccccattcgaccgcat
ccggagcggattgcgccgatgcgggaccgtcaactggccatgtccgtgcagacatctggc
ggcggagccttcccggagaaaaccgcacgtggcggcactcccatcaagcgcgccaagtgg
catctgggcatccggtcgcagagcaagcccaacgacataatgctcgaggtataccgagcg
atgaaggcactcagctacgagtggaagatcattaatccataccacgttcgagtgcgcagg
cagaacgtgaagaccggcaagttctcgaagatgtcactgcagctgtaccaggtggacgcc
aagagctatctgctcgacttcaagtcgctgactaacgacgaggtcgagcagggcgacgac
gtcatcatggagagccttactccgccgccgcttagcgtgtccggggtgatgccgctgcag
ccgaccgggcaccacaccatggagtttttcgaaatgtgcgccgccctgatcattcaactg
gctcgctga

DBGET integrated database retrieval system