KEGG   Drosophila simulans: Dsimw501_GD16790Help
Entry
Dsimw501_GD16790  CDS       T01065                                 

Gene name
Dsim_GD16790
Definition
(RefSeq) GD16790 gene product from transcript GD16790-RA (EC:3.4.19.-)
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsimw501_GD16790 (Dsim_GD16790)
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C86
   Dsimw501_GD16790 (Dsim_GD16790)
Ubiquitin system [BR:dsi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    Dsimw501_GD16790 (Dsim_GD16790)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 227 aa AA seqDB search
MESPSARTLGNSPGDDSGNGNGNENGNGNGNGSGNGNTTMMPHGIYHERQTRHLCGLHAL
NNLFQGLDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIMFALQQRNCEAMWFD
RRRDPHCLNLSAIFGFILNVPAQMSLGYYIPLPFQMRHWLALRCLNGSYYNLDSKLREPK
CLGNEEQFLEFLATQLQMDHELFLVLDEETDCKNKCRQRWLLPQFRD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcccagcgctcgaacactcggcaattccccgggcgatgacagcggcaacggg
aatggaaacgagaatggaaacggtaatggaaatggaagtgggaacggaaacaccacgatg
atgccgcatggaatctaccatgagcgacagactcgccacctgtgcggcctccacgccctg
aacaatctgttccaggggctcgacatgttctccaaatcggaactggacgactactgcacc
acactgaccccgcgcaactggctgaatccgcatcgatcgtggatcggttggggcaactac
gacgtcaatgtgatcatgttcgcactgcagcagcggaattgcgaggcgatgtggttcgat
cgccggcgggatccacactgtctcaatctgagcgccattttcggcttcattcttaatgtg
ccggcccagatgagcctgggctactacattccgctgcccttccagatgcgccactggctg
gcactgcgttgcttgaacggcagctactacaatctggactccaagctgcgcgagcccaag
tgcctgggcaacgaggagcagttcctcgagtttctggccacccaactgcagatggatcac
gagctattcctcgtgctggacgaggagacggactgcaagaataagtgccgtcaacgttgg
ctgctgccgcagttcagggattaa

DBGET integrated database retrieval system