KEGG   Drosophila simulans: Dsim_GD16874Help
Entry
Dsim_GD16874      CDS       T01065                                 

Gene name
Dsim_Tbh
Definition
GD16874 gene product from transcript GD16874-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dsi  Drosophila simulans
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dsi00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 561 aa AA seqDB search
MLKMPLQLSSQDGIWPARSRRLHHHHQLAYHHQKQQQQKQKQNGVQQGRSPTFMPVMLLL
LMATLLTRPLSAFSNPIIASPGVRVRCIKCPRAPEPKCPSARVPKRVVLSNIEEWKKFQI
EGVAIKGRGQEQLAGNMEYGRSGAGPSGAECELDHMEITLQEAAIPSQETTYWCHVQRLE
GNLRRRHHIVQFEPLIRTPGIVHHMEVFHCEAGEHEEIPLYNGDCEQLPPRAKICSKVMV
LWAMGAGTFTYPPEAGLPIGGPGFNPYVRLEVHFNNPEKQSGLVDNSGFRIKMSKTLRQY
DAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPATGIIIFGSQLHTHLRGVRV
LTRHFRGEQELREVNRDDFYSNHFQEMRTLHYKPRVLPGDALVTTCYYNTKDDKTAALGG
FSISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFIYMKRTEHQHGVHLNGARSSNYRS
IEWTQPRIDQLYTMYMQEPLSMQCNRSDGTRFEGRASWEGVAATPVQIRIPIHRKLCPNY
NPLWLKPLEKGECDLLGECIY
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaatgccgctgcagctgagcagtcaggatggcatttggccagcccgatcccgg
cgtctccaccaccaccaccaactggcttatcatcatcaaaagcagcagcagcagaaacaa
aagcaaaatggagtgcagcaaggacgttcgccgacattcatgccagtgatgctgctcctc
ctgatggccactctgctcacgcgcccgctgagcgccttctccaatcccattatcgcatcg
ccgggcgttcgagtgcgatgcatcaagtgcccaagagccccagagcccaagtgcccaagt
gcccgagtgcccaaaagggtcgtcctgtccaacatcgaagaatggaaaaaattccaaatc
gagggcgttgcgattaaggggcgtggccaggagcagctagcagggaatatggaatatgga
aggagtggagccgggccgagtggtgcggagtgcgagctggatcacatggagatcaccctg
caggaggcggcaattcccagccaggagaccacctactggtgtcacgttcagcgactggag
ggcaatctccggcgtcgccatcacatcgtccagttcgagccgctcatccggacgccgggc
atcgtgcaccacatggaagtcttccactgcgaggccggcgagcacgaggagattcccctg
tacaacggcgactgcgaacaattgccgccacgggccaagatctgctctaaagtgatggtc
ctgtgggccatgggagccggcacctttacctatcctccggaggccggcctgccaatcggc
ggacccggcttcaatccgtatgttcggctggaggttcatttcaataatccggaaaagcag
tctggcttggtggacaactccggcttccgcatcaagatgtcaaagacactgcgccagtat
gacgccgccgtaatggaactgggcctggagtacaccgacaaaatggccattccgcctggc
caaaccgcttttccgctgagcggctactgtgtggcggactgcactcgagccgctctgccg
gcgacgggcatcatcatctttggctctcagctgcatacccatctgcgtggcgtccgcgtc
cttacccgccactttcgcggcgagcaggagctgcgcgaggtgaaccgcgatgacttctac
tcgaatcacttccaggagatgcgcaccttgcactacaagccacgtgtcctgcccggcgac
gctttggtaaccacttgctactacaacactaaggatgacaagaccgccgccctcggcgga
ttctccatcagcgacgagatgtgcgtcaactacatccactactatccggccaccaaactg
gaggtctgcaagagttccgtttccgaggagacgctcgagaattactttatttacatgaag
cgcacggagcatcagcacggcgtgcatctgaatggagccaggtcgtccaattaccggagc
atcgagtggacccagccgcggatcgatcagctgtacaccatgtacatgcaggagccgctg
agcatgcagtgcaacaggtccgatggcactcgcttcgaggggcgggccagctgggagggc
gtggcagcgacgcccgtccaaatccgcatacccattcaccgcaaactgtgccccaactac
aatccgctgtggctgaagccattggagaagggcgagtgcgatttgctgggggagtgcatc
tattag

DBGET integrated database retrieval system