KEGG   Drosophila simulans: Dsim_GD16874Help
Entry
Dsim_GD16874      CDS       T01065                                 

Gene name
Dsim_Tbh
Definition
GD16874 gene product from transcript GD16874-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dsi  Drosophila simulans
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dsim_GD16874 (Dsim_Tbh)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dsim_GD16874 (Dsim_Tbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 561 aa AA seqDB search
MLKMPLQLSSQDGIWPARSRRLHHHHQLAYHHQKQQQQKQKQNGVQQGRSPTFMPVMLLL
LMATLLTRPLSAFSNPIIASPGVRVRCIKCPRAPEPKCPSARVPKRVVLSNIEEWKKFQI
EGVAIKGRGQEQLAGNMEYGRSGAGPSGAECELDHMEITLQEAAIPSQETTYWCHVQRLE
GNLRRRHHIVQFEPLIRTPGIVHHMEVFHCEAGEHEEIPLYNGDCEQLPPRAKICSKVMV
LWAMGAGTFTYPPEAGLPIGGPGFNPYVRLEVHFNNPEKQSGLVDNSGFRIKMSKTLRQY
DAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPATGIIIFGSQLHTHLRGVRV
LTRHFRGEQELREVNRDDFYSNHFQEMRTLHYKPRVLPGDALVTTCYYNTKDDKTAALGG
FSISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFIYMKRTEHQHGVHLNGARSSNYRS
IEWTQPRIDQLYTMYMQEPLSMQCNRSDGTRFEGRASWEGVAATPVQIRIPIHRKLCPNY
NPLWLKPLEKGECDLLGECIY
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaatgccgctgcagctgagcagtcaggatggcatttggccagcccgatcccgg
cgtctccaccaccaccaccaactggcttatcatcatcaaaagcagcagcagcagaaacaa
aagcaaaatggagtgcagcaaggacgttcgccgacattcatgccagtgatgctgctcctc
ctgatggccactctgctcacgcgcccgctgagcgccttctccaatcccattatcgcatcg
ccgggcgttcgagtgcgatgcatcaagtgcccaagagccccagagcccaagtgcccaagt
gcccgagtgcccaaaagggtcgtcctgtccaacatcgaagaatggaaaaaattccaaatc
gagggcgttgcgattaaggggcgtggccaggagcagctagcagggaatatggaatatgga
aggagtggagccgggccgagtggtgcggagtgcgagctggatcacatggagatcaccctg
caggaggcggcaattcccagccaggagaccacctactggtgtcacgttcagcgactggag
ggcaatctccggcgtcgccatcacatcgtccagttcgagccgctcatccggacgccgggc
atcgtgcaccacatggaagtcttccactgcgaggccggcgagcacgaggagattcccctg
tacaacggcgactgcgaacaattgccgccacgggccaagatctgctctaaagtgatggtc
ctgtgggccatgggagccggcacctttacctatcctccggaggccggcctgccaatcggc
ggacccggcttcaatccgtatgttcggctggaggttcatttcaataatccggaaaagcag
tctggcttggtggacaactccggcttccgcatcaagatgtcaaagacactgcgccagtat
gacgccgccgtaatggaactgggcctggagtacaccgacaaaatggccattccgcctggc
caaaccgcttttccgctgagcggctactgtgtggcggactgcactcgagccgctctgccg
gcgacgggcatcatcatctttggctctcagctgcatacccatctgcgtggcgtccgcgtc
cttacccgccactttcgcggcgagcaggagctgcgcgaggtgaaccgcgatgacttctac
tcgaatcacttccaggagatgcgcaccttgcactacaagccacgtgtcctgcccggcgac
gctttggtaaccacttgctactacaacactaaggatgacaagaccgccgccctcggcgga
ttctccatcagcgacgagatgtgcgtcaactacatccactactatccggccaccaaactg
gaggtctgcaagagttccgtttccgaggagacgctcgagaattactttatttacatgaag
cgcacggagcatcagcacggcgtgcatctgaatggagccaggtcgtccaattaccggagc
atcgagtggacccagccgcggatcgatcagctgtacaccatgtacatgcaggagccgctg
agcatgcagtgcaacaggtccgatggcactcgcttcgaggggcgggccagctgggagggc
gtggcagcgacgcccgtccaaatccgcatacccattcaccgcaaactgtgccccaactac
aatccgctgtggctgaagccattggagaagggcgagtgcgatttgctgggggagtgcatc
tattag

DBGET integrated database retrieval system