KEGG   Drosophila simulans: Dsimw501_GD16880Help
Entry
Dsimw501_GD16880  CDS       T01065                                 

Gene name
Dsim_GD16880
Definition
(RefSeq) GD16880 gene product from transcript GD16880-RB (EC:2.7.11.-)
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3R
AA seq 354 aa AA seqDB search
MSQHNSQYVFNSKEDYNVILDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVM
LVREKSGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYL
ILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRG
YIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPF
AIHNRDVILMYSKICICDYKMPSYFTAQLRSLVESLMQVDTSKRLGNSNDGSSDVKGHPW
FQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFKDRYKSRINRHPELFANF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcacaattcgcagtacgttttcaactccaaggaagactacaacgttatccta
gacaacatgagtcgcgagttcgaagagcggtggaaccaccagacccagtcgccctacacc
aacctggaaaactatataacccgggccgtcctcggcaacggaagtttcggcactgtgatg
ctggtcagggagaagagtggcaagaactactatgccgccaagatgatgagcaaggaggat
ctggtgcggctgaagcaggtggcccacgtacacaacgagaagcacgtcctgaacgccgcc
cgattcccgttcctcatctacctggtggactcgacaaagtgcttcgactatctctaccta
atcctcccgctggtcaatggaggtgagctgttcagttaccatcgcagagttcgcaagttc
aacgagaagcacgccagattctatgccgcccaggtggcacttgctcttgagtatatgcac
aagatgcaccttatgtaccgtgatctgaagccggagaacattctgctcgatcagcgcggc
tacatcaaaataacggacttcggtttcactaagcgtgtggatggccgcacatcaacgctg
tgtggaaccccggaatacttggccccggagatcgttcagctccgaccctacaacaaatcg
gtggactggtgggcctttggtatcctagtgtacgagttcgtggcagggcggtctcccttt
gccattcacaatcgagatgtaatcctgatgtactccaagatctgcatatgcgactacaag
atgccctcttactttacggcccagctgaggagcctcgtcgagagcctcatgcaggtggac
acatcaaagcgtttaggaaactcgaacgacggctccagcgacgtgaagggtcatccgtgg
ttccagggcgtagattggttcggcattctcaaccaggaagtcaccgccccctaccagccc
accatttccggcgccgaagatctgtcgaacttcgagaacttcgagttcaaggatcggtac
aagtcccgaataaaccgccatcccgaattgtttgcgaatttttaa

DBGET integrated database retrieval system