KEGG   Drosophila simulans: Dsim_GD16891Help
Entry
Dsim_GD16891      CDS       T01065                                 

Definition
GD16891 gene product from transcript GD16891-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dsi  Drosophila simulans
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsim_GD16891
   04340 Hedgehog signaling pathway
    Dsim_GD16891
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dsim_GD16891
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dsim_GD16891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 356 aa AA seqDB search
MGPQPEQAQMHFSPKVDYILILDKLREDFNKKFATNTPSPSTGLDDYEIKATLGSGSFGK
VQLVRERESGIYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSL
YLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHS
PFSAHNRDVMSMYNKICEADYKMPSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEH
EWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDKPRPKAKTMRHEEAFADF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggtccccagccggagcaagcgcagatgcacttcagtccgaaggtggactacatcctc
atcctggacaagttgcgcgaggacttcaacaagaagttcgccaccaacacgccgtcgccc
agtacgggactggatgactacgagattaaggcgaccctcggatccggatccttcggcaag
gtgcagctggtgagggagcgcgagtccggcatttattacgcctccaagcagctcagcaag
gaccagatcgtgaagaccaaacaggtgagccacgtgatgagcgagaagaacgtactgcga
tcgatgacgttcccgaacacggtcaacctgatagcctcctacaaggacttcgacagcctc
tacctcgtcctgcctctaattggtggcggagagctcttcacctaccaccgaaaagtgcgg
aagtttacggaaaaacaggcccgcttctatgctgcccaggtgtttttggctctggagtat
ctgcatcattgcagcttgctctatagagacctcaaaccggagaacataatgatggataag
aacggatacttgaaagtgacagatttcggatttgccaagaaagtggaaacccgaacaatg
actttgtgcggaacgccggagtacctgccgccggagattatccaatcgaagccctacgga
accagcgtggactggtgggcttttggggtactggtctttgaattcgtcgctggacactcg
cccttctcagcccacaatcgcgatgtgatgagcatgtacaacaagatctgtgaggcagac
tataagatgcccagttacttcagtggagccctgcgtcatttggtggaccatttgctgcag
gtggatctctcgaagcgttttggcaacctgatcaacggcaatcgggacataaaggagcac
gagtggttcaaggatgtggagtggatccccctcctcaatcagacagttaacgcgccctat
gtgcccaacatcagcaatcccgaggatatatccaacttcgataaggtctctgataagccg
cggcccaaggcgaaaaccatgcgacacgaggaagccttcgcggatttttaa

DBGET integrated database retrieval system