KEGG   Drosophila simulans: Dsim_GD16891Help
Entry
Dsim_GD16891      CDS       T01065                                 

Definition
(RefSeq) GD16891 gene product from transcript GD16891-RA
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 356 aa AA seqDB search
MGPQPEQAQMHFSPKVDYILILDKLREDFNKKFATNTPSPSTGLDDYEIKATLGSGSFGK
VQLVRERESGIYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSL
YLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHS
PFSAHNRDVMSMYNKICEADYKMPSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEH
EWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDKPRPKAKTMRHEEAFADF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggtccccagccggagcaagcgcagatgcacttcagtccgaaggtggactacatcctc
atcctggacaagttgcgcgaggacttcaacaagaagttcgccaccaacacgccgtcgccc
agtacgggactggatgactacgagattaaggcgaccctcggatccggatccttcggcaag
gtgcagctggtgagggagcgcgagtccggcatttattacgcctccaagcagctcagcaag
gaccagatcgtgaagaccaaacaggtgagccacgtgatgagcgagaagaacgtactgcga
tcgatgacgttcccgaacacggtcaacctgatagcctcctacaaggacttcgacagcctc
tacctcgtcctgcctctaattggtggcggagagctcttcacctaccaccgaaaagtgcgg
aagtttacggaaaaacaggcccgcttctatgctgcccaggtgtttttggctctggagtat
ctgcatcattgcagcttgctctatagagacctcaaaccggagaacataatgatggataag
aacggatacttgaaagtgacagatttcggatttgccaagaaagtggaaacccgaacaatg
actttgtgcggaacgccggagtacctgccgccggagattatccaatcgaagccctacgga
accagcgtggactggtgggcttttggggtactggtctttgaattcgtcgctggacactcg
cccttctcagcccacaatcgcgatgtgatgagcatgtacaacaagatctgtgaggcagac
tataagatgcccagttacttcagtggagccctgcgtcatttggtggaccatttgctgcag
gtggatctctcgaagcgttttggcaacctgatcaacggcaatcgggacataaaggagcac
gagtggttcaaggatgtggagtggatccccctcctcaatcagacagttaacgcgccctat
gtgcccaacatcagcaatcccgaggatatatccaacttcgataaggtctctgataagccg
cggcccaaggcgaaaaccatgcgacacgaggaagccttcgcggatttttaa

DBGET integrated database retrieval system