KEGG   Drosophila simulans: Dsimw501_GD16914Help
Entry
Dsimw501_GD16914  CDS       T01065                                 

Gene name
Dsim_GD16914
Definition
(RefSeq) GD16914 gene product from transcript GD16914-RB
  KO
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dsi  Drosophila simulans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo and isoglobo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dsimw501_GD16914 (Dsim_GD16914)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dsimw501_GD16914 (Dsim_GD16914)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dsimw501_GD16914 (Dsim_GD16914)
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dsimw501_GD16914 (Dsim_GD16914)
   00511 Other glycan degradation
    Dsimw501_GD16914 (Dsim_GD16914)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsimw501_GD16914 (Dsim_GD16914)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dsimw501_GD16914 (Dsim_GD16914)
Chaperones and folding catalysts [BR:dsi03110]
 Intramolecular chaperones
  Others
   Dsimw501_GD16914 (Dsim_GD16914)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 622 aa AA seqDB search
MRFSGYNRYQCFCSAVSSLLLLSLLSFAVGAALTRADDVGSDADAGSASRKWLCSRTDIC
TAEGEMVTGLQYAPEIFESQRDCRLSCGKYGAIWPMPTGKECTISHRRVRFDPWKVRFHV
VAPGEAATQFLRETNRLFVSNLLKECIRNCTLETSKQILVRSTVANESLVLDWPTDESYA
LVVRTTETATFVDIQATTVYGARHAFETLSNLVTGSLSNGLLMVTTANITDRPAFSHRGV
LLDTARNFVPLKFIRSTLDAMAASKLNVLHWHVVDTHSFPLEITRVPEMQRYGAYSSSQT
YSRQDALNLVKYARLRGIRILIEIDGPSHAGNGWQWGPAAGLGNMSVCLNQSPWRRFCVQ
PPCGQLNPLNDHMYAVLKEIFEDVAEVGAPEETLHMGGDEVFLPCWNNTDEIRDGMRARG
YDLSEQSFLRLWSQFHQRNLNAWDEINERMYPGIKEPKSVIIWSSHLTNPRYIEAYLPKE
RFIIQTWVESQDALNRELLQRGYRLIVSTKNAWYLDHGFWGSTSYYNWRTVYSSGMPVGR
SKDQVLGGEVCMWSEYVDQNSLESRIWPRAGAAAERMWSNPKSSALLAQRRFYRYRERLL
ARGIHADAVIPHWCVLHEGQCL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcagcggctacaatcgttatcagtgcttctgctctgccgtttcatcgctgctg
cttttatccttattatccttcgcggtcggcgctgcgctgacgcgggcagatgacgtcggc
agcgacgccgacgccggcagcgccagcaggaaatggctgtgcagccggacggacatctgc
accgcggagggcgaaatggtgaccggactgcagtacgcgccggagatcttcgagagccag
cgcgactgccgactgtcgtgcggaaagtacggagccatctggcccatgcccaccggcaag
gagtgcaccatatcgcacaggcgagtgcggttcgatccgtggaaggtgcgtttccatgtg
gtggcgcccggcgaggcggccactcagttcctcagggagacgaaccggctgttcgtctcg
aatctgctgaaggagtgcatacggaactgcacgctggagaccagcaagcagattctggtc
aggtccacggtggccaacgagagcctcgtcctggactggcccaccgacgagagttacgcc
ctggtggtgcgaaccacggagacggccacatttgtagacatccaggcgacgacggtgtac
ggagcacgtcatgccttcgagacgctgagcaacctggtcaccggcagcctgtccaatggt
ctgctgatggtcaccacggccaacatcaccgatcgtccggccttttcgcatcgcggcgtg
cttctggatacggcccgtaactttgtgccgctcaagttcatacgcagcaccttggatgcg
atggcggccagtaagctgaatgtgctccactggcatgtggtggacacgcacagttttccg
ctggagatcaccagggtgccggagatgcagcgttacggagcgtactcctcatcgcagacg
tactcgcgccaggatgcactgaatctggtcaaatatgcccgactgcggggcatacggata
ctgatcgagatcgatggaccctcgcatgcgggcaatggctggcaatggggtcctgccgcc
ggactgggcaacatgtccgtgtgcctgaaccaatcgccctggaggagattctgtgtgcag
ccaccgtgcggccaactgaatcccctgaacgatcacatgtacgcggtgctcaaggagatc
ttcgaggacgtagccgaggtgggcgctcccgaggagaccctgcacatgggcggcgacgag
gtgttcctgccctgctggaataacaccgacgagattcgggatggcatgcgggcacgcggc
tacgatctcagcgagcagagcttcctgcggctgtggtcgcagttccatcagcggaacctc
aatgcatgggacgagattaacgagcgtatgtatccgggcatcaaggagcccaagtcggtg
atcatctggtccagccacctcaccaatccccggtacatcgaggcctacctgcccaaggag
cggttcataatccagacctgggtggagtcgcaggatgccctcaatcgggagctcttgcag
cggggctaccgactgattgtgtccacgaagaatgcctggtacctggatcacggcttctgg
ggcagcacatcgtactacaactggcgcaccgtgtactccagtggcatgcccgttggtcgc
agcaaggatcaggttctcggcggtgaggtgtgcatgtggagcgagtatgtggatcagaac
tcactggaatcccgaatctggccgcgagctggagcagcagccgagcgaatgtggtctaat
ccgaagtcttctgccctgctggcccaaagaaggttctaccgctaccgggagcgactcctg
gcccgcggaatccatgcggatgcagtaatcccgcactggtgcgtcctccacgaaggacag
tgcctctaa

DBGET integrated database retrieval system