KEGG   Drosophila simulans: Dsim_GD16945Help
Entry
Dsim_GD16945      CDS       T01065                                 

Gene name
Dsim_Dsor1
Definition
GD16945 gene product from transcript GD16945-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dsi  Drosophila simulans
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsim_GD16945 (Dsim_Dsor1)
   04068 FoxO signaling pathway
    Dsim_GD16945 (Dsim_Dsor1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dsim_GD16945 (Dsim_Dsor1)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dsim_GD16945 (Dsim_Dsor1)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dsim_GD16945 (Dsim_Dsor1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 336 aa AA seqDB search
MGDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLREKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
TGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLI
HPWIGKAEKEEVDISGWVCKTMDLSPSTPKRNTSPN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacacggaacgcaagcggatcaaggtcttcctcagccagaaggagaagatcggc
gagctgtccgacgaggatctggagaagctgggcgagctgggatcgggcaatggcggcgtg
gtgatgaaggtccggcacacgcacacacacctgatcatggccaggaaactgatccatctg
gaggtgaagccggcgatcaagaaacagatcctgcgcgaactgaaagtcctgcacgaatgt
aatttcccgcacattgtcggtttctacggcgccttttacagcgacggcgagatcagtatc
tgcatggagtatatggacggtggatcacttgacctgatcctcaagcgggccggtcgaata
ccggagtccatccttggcaggatcacgctggccgtgcttaagggcttgagctatctgcga
gaaaaacacgccatcatccaccgtgacgtcaagccgagcaatatcctcgtcaacagcagc
ggcgagatcaagatctgtgatttcggcgtctctggccaactgatcgactcgatggccaac
tcctttgtgggcacccgaagctatatgtcgccggagcgactgcaaggcacccactactcc
gtgcagtcggacatctggtcgttgggcctgtcgctggtggagatggccatcggcatgtac
cccatcccgccgccaaacaccgccaccctggagtcgatattcgccgacaatgcggaggag
accggacagccgacggacgagcccagggcaatggccatcttcgagctgctggattacatt
gtgaacgaaccgccgcccaagctagagcacaagatcttctccaccgagttcaaggacttc
gtggacatatgcctgaagaaacagcccgacgagcgggcagatctcaagaccctgctgatt
catccgtggataggcaaggcggaaaaggaggaggtggatatatccggctgggtgtgcaag
acaatggatctgtcgccgtcgacgccaaagcgtaatacgtcgcccaactag

DBGET integrated database retrieval system