KEGG   Drosophila simulans: Dsim_GD17022Help
Entry
Dsim_GD17022      CDS       T01065                                 

Definition
GD17022 gene product from transcript GD17022-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dsi  Drosophila simulans
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dsi00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 653 aa AA seqDB search
MTANTATSEENLLGKGGQPHEPSTPTSDTEVGGGTPTELSEIFFVDNSRRKQSIKIQVKL
CPEGVYLRRETDEDDHINEQLIRIDDIIGSRYGPRLKKRARGGLNSCRNPNVPGQEADPE
PDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYGVNLQTAELWHHTIRRHKRGNG
SSSPADCGKQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRT
RRDLLERYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPLGIIPCGSGNGLAKSVAHH
CNEPYEPKPILHATLTCMAGKSTPMDVVRVELAPRDKHFVMYSFLSVGWGLIADIDIESE
RLRSIGAQRFTLWAIKRLIGLRSYKGRVSYLLAKGKKEPPVEAAKEAREMPAESDQPKRP
STAAAIRSSLPLNAGEFHDLPEEEEVEEEAVLDGEQFADAISLDRSVYRQHADSWHSAMS
RRTAYYSLGGPSMRSNRSRMSISQRIEAANAEFAERVPTGTIPGLQMPLPSSEGWICEDG
DFVMVHAAYTTHLSSDVFFAPESRLDDGLIYLVIIRSGVSRHQLLNFMLSLNTGTHLPIG
EDPFIKVVPCRAFRIEPSSSDGILVVDGERVEYGPIQAEVMPGLINVMTTSGQ
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaacacagcgacgtcggaggaaaatctgctgggaaaaggtggacagccgcat
gagccctccacgcccacctcggatacggaagtgggcggcggcacgcccacggaactgagc
gagatcttcttcgtggacaacagccggcgcaagcagagcatcaaaatccaggtgaaactg
tgcccggaaggcgtttacctgcgtcgcgaaaccgacgaagatgaccacatcaatgagcag
ctgatcaggatcgatgatatcataggttcgcgctacggaccgcgtttgaagaaacgagcc
cgaggaggtctaaactcttgccgcaatcctaatgttccgggccaggaggcggatccggaa
ccggatagcgataatagcgcctatttgtacatctatgcttacttgaagaaggagaaaccg
ttgcggcgtgtccaaacgctcaggattctacgctttcgttcgagcaatgactacggggtg
aatctacagaccgccgagctgtggcatcatacgattcgaaggcacaagcgtggcaatggc
agcagttcgcccgccgattgtggcaaacagttgctcatcctactgaatccgaagtccggt
tcgggcaaggggcgtgagctcttccagaaacaggtggcacccttgctgacggaggcagag
gtgcaatacgatctccagatcaccacacatccgcagtacgccaaggagttcgtgcggacc
aggagggatctgctggaacgctactcaggcattgtggttgcctccggcgatggtctgttc
tacgaagtgctcaatgggctgatggagcgcatggattggcgccgagcctgcagggagctg
ccgcttggcatcataccatgtggctccgggaatggtctggccaaaagtgtggcccatcac
tgcaacgaaccgtacgagccgaagcccattctccatgccaccttgacctgcatggcgggc
aaaagtacgcccatggatgtggtccgagtggagctggcaccgcgggacaagcactttgtg
atgtactccttcctgtcggtgggctggggtctgatagccgacatcgatatagagagcgag
cgattgagatcgattggagcgcaaaggtttacgctgtgggccatcaagcgattaatcggg
ctgcgcagctacaagggacgagtgtcctatctactggccaagggcaagaaggaaccacca
gtggaagcggcaaaggaggctcgagagatgccggcagaatcagaccaaccgaagcgaccg
tcaaccgctgcagcaatccgttcatctctgcctctgaatgccggggaattccatgatcta
cccgaggaggaggaggtggaggaggaagcggttttggatggagaacagttcgccgatgcc
atatccctggatcgttcggtttatcgccagcatgccgacagttggcactcggccatgtcc
aggcgaacggcatattactccctgggcggacccagcatgcgatccaatcgcagccggatg
agcattagccagcggatcgaagcggccaatgcggaattcgctgagagggtgccaacgggc
accattccgggattacagatgccactgcccagcagcgagggttggatctgcgaggatggt
gactttgtgatggtccatgccgcctatacgacccatctctcctccgacgttttctttgcg
cccgaatcccgtctggacgatggcctcatctacctggtgatcatccggagtggcgttagt
cgccatcagctgctcaatttcatgctgagcctaaacacgggcacccatctgcccatcggc
gaggatccgttcatcaaggtggtgccctgtcgggcattccgcatcgagccgagcagctcc
gatggcatcctggtggtggacggcgagcgggtggaatacggacccattcaggcggaggtt
atgcccggcctgatcaatgtgatgaccaccagtggtcagtag

DBGET integrated database retrieval system