KEGG   Drosophila simulans: Dsim_GD17212Help
Entry
Dsim_GD17212      CDS       T01065                                 

Definition
GD17212 gene product from transcript GD17212-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dsi  Drosophila simulans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dsim_GD17212
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dsim_GD17212
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dsim_GD17212
Lipid biosynthesis proteins [BR:dsi01004]
 Desaturase
  First
   Dsim_GD17212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 420 aa AA seqDB search
MCLSSPIPGQKQTPSVGHCNGSCSLDRNGNRSEPSVPNGGELKHRGHATDATSHTLVKDE
DNLGYKEENAVYKEQQLLQQQDQKLKEAEQVEEEEEYHPQIRWPDLGAQAFLHIGALYGL
YQLFYANFYTFLWVVVTVWVSGIGITAGAHRLWSHKSYTASLPLRILLAFAFSIAGQRDA
YTWALDHRIHHKFSETDADPHNAKRGFFFAHVGWLFLTPHPKVVAKRKVIDMSDLEADAV
CMFQRKYYIPLFALCSIILPVAVPWYFWNEDLWMSFWINFNMRFTWTLNVAFFVNSVAHM
YGNKPYDKNLMSTEAPIVSLLAMGEGWHNYHHVFPWDYKTGEFGNYSLNITTGFIDFCAW
LGLATGRKSVSPDMVLRRAKKCGDGTRFLDDDHAHKDPVWGFGDKDIPREDIVELAKMQN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctttcatccccgattcccggccagaagcagacaccgtctgttggccactgcaac
ggatcgtgtagcctggacaggaatggcaaccgcagcgaacccagtgtcccgaatggagga
gagctgaagcacagaggccatgccacagacgctacatcacacaccctggtcaaagatgag
gacaatctgggctacaaggaggagaacgcggtctacaaggagcagcagctgctgcagcaa
caggaccagaagctgaaggaggcggagcaggtggaggaggaggaggagtaccacccgcag
atcagatggcccgatctgggggcacaggccttcctgcacatcggtgccctctacggactg
taccagctcttctacgcgaacttctacacattcctctgggtggtggtcaccgtttgggtc
tccggcatcggcatcacggcgggagcccatcgcctctggtcccacaagtcctacactgcc
tcgctgcccctgaggattctgctggccttcgccttttcgatcgccggacagagagatgcc
tacacgtgggcccttgatcacaggatacatcacaagttctcggagacagacgccgatccg
cacaatgcgaagcgtggtttcttcttcgcccacgtgggctggctgttcctcacgccccat
cccaaggtggtggccaagaggaaggtcatcgacatgtctgacctggaggcggatgccgtc
tgcatgttccagcggaagtactacataccgctcttcgcgctctgctccatcatcctgccg
gtggccgtgccctggtacttctggaacgaggacctctggatgtccttctggatcaacttc
aacatgcgcttcacctggaccctcaacgtggccttcttcgtgaacagcgtagcgcacatg
tatggcaacaagccgtacgacaagaaccttatgtccactgaggctcccatcgtctccctg
ctggccatgggagagggatggcacaactaccaccacgtcttcccctgggactacaagacg
ggcgagtttggcaactacagcctcaacatcaccactggcttcatcgacttttgcgcctgg
ctgggcctggccacaggacgtaaatcggtatcccctgacatggtcttgaggagagctaag
aaatgcggcgatggaactcgcttcctggacgacgaccatgcccacaaggatccggtgtgg
ggcttcggggacaaggacattccccgagaggatatcgtggagctggccaagatgcagaac
taa

DBGET integrated database retrieval system