KEGG   Drosophila simulans: Dsim_GD17212Help
Entry
Dsim_GD17212      CDS       T01065                                 

Definition
GD17212 gene product from transcript GD17212-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dsi  Drosophila simulans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dsi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dsi01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 420 aa AA seqDB search
MCLSSPIPGQKQTPSVGHCNGSCSLDRNGNRSEPSVPNGGELKHRGHATDATSHTLVKDE
DNLGYKEENAVYKEQQLLQQQDQKLKEAEQVEEEEEYHPQIRWPDLGAQAFLHIGALYGL
YQLFYANFYTFLWVVVTVWVSGIGITAGAHRLWSHKSYTASLPLRILLAFAFSIAGQRDA
YTWALDHRIHHKFSETDADPHNAKRGFFFAHVGWLFLTPHPKVVAKRKVIDMSDLEADAV
CMFQRKYYIPLFALCSIILPVAVPWYFWNEDLWMSFWINFNMRFTWTLNVAFFVNSVAHM
YGNKPYDKNLMSTEAPIVSLLAMGEGWHNYHHVFPWDYKTGEFGNYSLNITTGFIDFCAW
LGLATGRKSVSPDMVLRRAKKCGDGTRFLDDDHAHKDPVWGFGDKDIPREDIVELAKMQN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctttcatccccgattcccggccagaagcagacaccgtctgttggccactgcaac
ggatcgtgtagcctggacaggaatggcaaccgcagcgaacccagtgtcccgaatggagga
gagctgaagcacagaggccatgccacagacgctacatcacacaccctggtcaaagatgag
gacaatctgggctacaaggaggagaacgcggtctacaaggagcagcagctgctgcagcaa
caggaccagaagctgaaggaggcggagcaggtggaggaggaggaggagtaccacccgcag
atcagatggcccgatctgggggcacaggccttcctgcacatcggtgccctctacggactg
taccagctcttctacgcgaacttctacacattcctctgggtggtggtcaccgtttgggtc
tccggcatcggcatcacggcgggagcccatcgcctctggtcccacaagtcctacactgcc
tcgctgcccctgaggattctgctggccttcgccttttcgatcgccggacagagagatgcc
tacacgtgggcccttgatcacaggatacatcacaagttctcggagacagacgccgatccg
cacaatgcgaagcgtggtttcttcttcgcccacgtgggctggctgttcctcacgccccat
cccaaggtggtggccaagaggaaggtcatcgacatgtctgacctggaggcggatgccgtc
tgcatgttccagcggaagtactacataccgctcttcgcgctctgctccatcatcctgccg
gtggccgtgccctggtacttctggaacgaggacctctggatgtccttctggatcaacttc
aacatgcgcttcacctggaccctcaacgtggccttcttcgtgaacagcgtagcgcacatg
tatggcaacaagccgtacgacaagaaccttatgtccactgaggctcccatcgtctccctg
ctggccatgggagagggatggcacaactaccaccacgtcttcccctgggactacaagacg
ggcgagtttggcaactacagcctcaacatcaccactggcttcatcgacttttgcgcctgg
ctgggcctggccacaggacgtaaatcggtatcccctgacatggtcttgaggagagctaag
aaatgcggcgatggaactcgcttcctggacgacgaccatgcccacaaggatccggtgtgg
ggcttcggggacaaggacattccccgagaggatatcgtggagctggccaagatgcagaac
taa

DBGET integrated database retrieval system