KEGG   Drosophila simulans: Dsim_GD17219Help
Entry
Dsim_GD17219      CDS       T01065                                 

Definition
GD17219 gene product from transcript GD17219-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dsi  Drosophila simulans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dsi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 480 aa AA seqDB search
MLLQLRQLPILFLLHRILALSVPMVEQVQRAEELLSSHWLGQAQTQLRERLARTKDSIAD
VRQAKNVVMLLGDGLSITTLTAARILKGQRRGGSGEEAQLAVERFPFTGLSKTYCIDEQT
PDSACTATAYFGGVKTHSGTVGQSGSGERVDSVLQWAQRAGKATGVVTTTRLTDASPAGA
YAHVSRRGEELEIARQLVEEEPGRNLNVILGGGLGKFADERRDGKDLLAQWRESNPNGCF
ARSLKELRNCSDATGTLLGLFSDSHMSYHLAASKELPRLCDMAAAAIEKLERKSQEDGNG
YFVFIEGGRIDHGHHETRVGYALDEMLEFDAAVETVIQMTDPRDTLVVVTADHSHTLSMS
GYAKRGTPILGMGAQQRDVNGVPYSTLNYAIGKWQSLDKDGRRESPSKTLSPTSYTPSYI
HGRKGVHSGEDVVVFAMGPQSHLFGGVMEQNLLPHLMGYAACLGNSVTLCNQDTDADLTG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgttgctccaattgaggcaattgccgatcctgttcctgctccaccgcatccttgcgcta
tctgttcccatggtggagcaagtgcagcgggcggaggagctgctatcgtcgcattggtta
ggccaggcgcagactcagttgcgcgaacgtctggccagaaccaaggactccatcgccgac
gtccgacaggccaagaatgtggtgatgctcctgggcgatggactgtccatcaccacctta
acggccgcccgcattctgaaggggcaacggcgtggaggaagcggtgaggaggcgcagttg
gccgtggaacgattcccctttaccggactgagcaagacgtactgcatcgacgagcagaca
ccggactccgcctgcacggccaccgcctatttcggcggtgtgaagacgcacagcggcaca
gtgggtcaaagtgggagtggtgagcgcgtggactccgtactccagtgggcacagcgagcg
ggaaaggccacgggagtggtgaccaccacccgtttgacggacgccagtccggcgggtgcc
tacgcccatgtgagcaggcgcggcgaggagctggagattgcgcgacagctggtggaggag
gagccgggaaggaatcttaatgtcatcctgggtggtggtctgggcaaatttgccgatgag
cgacgggatggcaaggatctgctggctcagtggcgtgaatcgaatcccaatggctgcttc
gcgcgatccttgaaagagctgaggaactgcagcgatgctaccggtacactgctgggtctc
ttcagcgacagccacatgtcctatcacctggccgccagcaaggagctgccgcgtctctgc
gacatggcagcggcggccattgaaaaactggagagaaagtcccaggaggatgggaatggt
tacttcgtgttcattgagggcggacggattgatcatggacaccatgaaacccgggtgggc
tacgccctcgatgagatgctcgagttcgatgcggctgtggagacggtgatccagatgacc
gatccgcgcgatactctggtggtggtcaccgccgatcattcgcacacgctcagcatgtcg
ggatacgcgaagcggggcacacccatcctgggcatgggtgcacagcagcgggatgtgaac
ggggtgccatacagcaccctcaactatgccatcggcaagtggcagagcctggacaaggat
ggacggcgggagagtcccagcaagaccctgagtcccacatcctacacgcccagctatatt
catggaaggaagggcgtgcattctggcgaggatgtggtcgtatttgcaatgggcccgcaa
tcccatctgttcggtggcgtcatggagcagaatctgctgccccatctcatgggctatgcc
gcttgtctgggcaatagcgtcactctctgcaaccaggacacggatgcggatttgactgga
taa

DBGET integrated database retrieval system