KEGG   Drosophila simulans: Dsim_GD17252Help
Entry
Dsim_GD17252      CDS       T01065                                 

Definition
GD17252 gene product from transcript GD17252-RA
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 512 aa AA seqDB search
MSGATQEFCVRWNSHLGSIGAAFPQLLAGQRFVDVTLACEGQQVHCHRLVLAACSTYFEA
ILAEHPCKHPVIILPREIKLWEIQALVDFMYKGEVNVTQAGLGQLLRCAEQLQIRGLYGS
EAPINYKKLQQASLEAAKDPAATTARSFKHVDSAETDDAATNSTTSTMTTSSAPPLPVNH
QQPTVLKRQNPDARQQQQQQQQQLQQRPQINGSNAQQPSKATSANVLGSHSNAPTEDDSG
DEVPNNWNAYGEQFEDCNISAQAVDNKMNVHLSLQQSRMQMQLQQQQYLDSNVEDDHNYV
AAHDENNDSSFATGVPCGSGLSVSLDTDLDTSANTSGGLSHSSIDGYTSYKRVRRSEASL
AQAAKCVSKGETFQTVSNMFNIPVSTIRFYMARKGILPKRKRGRGASHAGNIIITTNSGK
LSTVPASITHPPAHPHIHTNPLPHTQSQQMSMDSLHLKAGITNTSGSNSPATATATSMSP
SFDMATTGDIVPFHLHSDAAAFKLNDQKLHMI
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgctacacaggaattttgtgtacgctggaacagccatttgggcagcattgga
gctgcttttccgcagctgctggcgggccagagattcgtggacgtaacactcgcatgcgaa
ggccaacaggtgcactgccatcgtctggtgttggccgcctgttccacctactttgaggcg
atactggcggagcatccttgcaagcacccggtcatcatattgcccagggagatcaagcta
tgggagatccaggcgcttgtggacttcatgtacaagggagaggtcaatgtcacgcaagcc
ggtcttggccagttgcttcgctgtgccgaacaactgcagattcgcggtctatacggctct
gaggcaccgataaactacaagaaactgcagcaggctagtctggaggcagctaaggatcca
gctgcaaccacagcgcgaagtttcaagcatgtggacagcgcggagacggacgatgcagcc
actaattcaaccacctcaacaatgaccacctcctccgctccaccgctaccggttaaccat
cagcaacccacagtattgaagcgccagaatcccgatgctcggcagcagcaacagcagcag
cagcagcagctacagcagcgaccccagataaatggcagtaatgctcaacagccatctaag
gccacctctgcgaacgttttgggcagccactcgaatgcaccgaccgaggacgactccggc
gacgaggtgccgaacaattggaatgcctacggggagcaattcgaggattgcaatatatct
gcgcaagccgttgacaacaaaatgaatgtccacctatccctgcagcaatcgcggatgcaa
atgcagcttcagcagcagcaatacttggattcaaatgttgaggacgaccacaactatgtg
gccgctcatgatgaaaacaatgacagcagttttgcgacaggagtgccatgcggatccggg
ctatccgtcagccttgacactgatctcgatacatcggccaatacttccggcggactgagc
catagctcgatcgatggttatacttcatataagcgcgttcgacgttcagaagcatctcta
gcacaagcggccaaatgtgtttcgaagggcgagacattccaaactgtcagcaatatgttc
aatattcctgtctcaaccattcgtttctatatggcgcgaaaaggaattcttccgaagcgg
aaacgtggacgtggtgcttcccatgccggaaacataataatcacaacaaactcaggaaaa
ctctcaaccgtcccagcgagcataactcatcccccagcccatccgcatatccacaccaat
ccccttcctcacacgcagtctcagcaaatgtccatggacagcctacatctcaaggcgggc
atcacaaataccagtggcagcaatagtccggcaacagctacggcaacgtctatgtcacca
tcatttgatatggccacaacaggtgatatcgtgccttttcacctccatagcgatgcggcg
gcattcaaactcaacgatcagaagctgcacatgatctaa

DBGET integrated database retrieval system