KEGG   Drosophila simulans: Dsim_GD17322Help
Entry
Dsim_GD17322      CDS       T01065                                 

Gene name
Dsim_Tpi
Definition
GD17322 gene product from transcript GD17322-RA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dsi  Drosophila simulans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsim_GD17322 (Dsim_Tpi)
   01230 Biosynthesis of amino acids
    Dsim_GD17322 (Dsim_Tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsim_GD17322 (Dsim_Tpi)
   00051 Fructose and mannose metabolism
    Dsim_GD17322 (Dsim_Tpi)
   00562 Inositol phosphate metabolism
    Dsim_GD17322 (Dsim_Tpi)
Enzymes [BR:dsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dsim_GD17322 (Dsim_Tpi)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dsim_GD17322 (Dsim_Tpi)
  Exosomal proteins of bladder cancer cells
   Dsim_GD17322 (Dsim_Tpi)
  Exosomal proteins of melanoma cells
   Dsim_GD17322 (Dsim_Tpi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 348 aa AA seqDB search
MPPGVLTKLNRNGIQCIASVTLLQRFPYHRNHHTIPTMDQNRPTVGGVTAEVLKAVVSQA
LLGKFTAVFPKLFKCQWKTYEGQKKFYANFSTDCTDSNSNNMSRKFCVGGNWKMNGDQKS
IAEIAKTLSSAALDPNTEVVIGCPAIYLMYARNLLPCELGLAGQNAYKVAKGAFTGEISP
AMLKDIGADWVILGHSERRAIFGESDALIAEKAEHALAEGLKVIACIGETLEEREAGKTN
EVVARQMCAYAQKIKDWKNVVVAYEPVWAIGTGKTATPDQAQEVHAFLRQWLSDNISKEV
SASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIINARQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctggtgtactcactaagctgaacaggaacggtatccagtgtattgcatcagta
acgcttctccagcgattcccatatcatcggaaccaccacaccattcccaccatggaccag
aaccgacccactgtgggtggtgttacggcggaggtactaaaagccgtcgtttcgcaagct
ctgctgggcaaattcacagctgttttcccaaagcttttcaagtgccagtggaagacttac
gaaggtcaaaagaagttctacgccaatttcagcaccgattgcaccgacagcaacagcaac
aacatgagccgaaagttctgcgtgggaggcaactggaagatgaacggcgaccagaagtcc
atcgccgagatcgccaagaccctgagctcggccgccctcgaccccaacacggaggtggtc
atcggctgcccggccatctacctgatgtacgcccgcaacctgcttccctgcgagctgggt
ctggccggccagaacgcctacaaggtggccaagggcgccttcaccggcgagatctcgcct
gcgatgctgaaggacatcggcgccgactgggtgatcctgggacactcggagcgccgcgcc
attttcggcgagtcggacgccctgatcgccgagaaggccgagcacgctctggccgagggc
ctcaaggtcatcgcctgcattggtgagaccctggaggagcgcgaggctggcaagaccaac
gaggtggtggcccgccagatgtgcgcctacgcccagaagatcaaggactggaagaacgtg
gtggtggcctacgagcccgtctgggccattggcaccggcaagaccgccacacccgatcag
gctcaagaggtccacgccttcctgcgccagtggctgagcgacaacatctccaaggaggtg
tccgccagcctccgcatccagtacggtggatccgtgaccgccgccaacgccaaggagctg
gccaagaagcccgacatcgatggcttcctggtcggaggcgcctccctgaagcccgagttc
gtggacatcatcaacgcccggcagtaa

DBGET integrated database retrieval system