KEGG   Drosophila simulans: Dsim_GD17342Help
Entry
Dsim_GD17342      CDS       T01065                                 

Definition
GD17342 gene product from transcript GD17342-RA
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dsim_GD17342
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   Dsim_GD17342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 414 aa AA seqDB search
MDTPRRKLRNLHLENVQNSSTPINVPPSPMMKTLGHGTGIRVYRLDRSPRLGEIRSPWAV
KRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVVTNDEGINTLALEMCTTSLG
SILEERHDEDLGPLPAKNTYKMIMDVAQGLDFLHNEARIMHGDIKSFNVLVKGEFEICKL
CDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEVIDEVDVIDSKADIFSFGLVIYETL
ALVPPHTLELDAALGEAMDSSHDLPTDTGKLQCKQLDFSSDEKKIGLPSAMEEHTDNDMS
QDYDEEDEEEKEEEEEEKEEDEDEKDWEEEEKEEDEEDDDTKENDISYFTLNNLHSAYGT
RPPLPVAFQLSDDYNCVVELFYLCTNALSEDRPAAKTIWQCLENNGANVATESD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccacgccgcaagctaagaaatttgcacctggagaatgtccagaacagcagc
actcccatcaacgtgccgccctcgccgatgatgaagaccctgggccacggcactgggatc
cgggtctaccgcttggaccgctcgcctcgtctcggcgaaatccgctcgccctgggccgtc
aagcggatcacgcagaacatgcgggtcaaaaaggacacactcttcaacgagcggattgtt
cacgaggccgatatcctgcgcaaactgaagcatccgaacatcgtgggattccgtggcgtt
gtcaccaatgacgagggcatcaacacactggcactcgaaatgtgcaccacttcactgggc
tccatattggaggagcgtcacgacgaggatctgggcccgttgccggccaaaaatacctat
aagatgatcatggacgtggcacagggactcgactttcttcacaacgaagcgcgcatcatg
cacggtgacatcaaatcctttaatgtccttgtgaagggcgagtttgagatctgtaagctg
tgcgattttggagtctctcttccgctggacgagcagggcgaggttaatttcctaaagaat
cccggactgcgctatgtgggaactaacctctggtgcgccccggaggtcatagacgaagtg
gatgttattgacagcaaggcagacatcttcagctttggcctggttatctacgaaaccctt
gctctggtgccaccacataccttggagctcgatgcagcactgggagaggctatggacagc
tcgcacgatttacccaccgacacgggcaagctgcagtgcaaacagttggacttctccagc
gatgaaaagaagatcggactgccttctgcaatggaagaacacacagacaacgatatgagt
caagattatgacgaggaggatgaggaggagaaggaagaggaggaggaggagaaggaagag
gatgaagacgagaaggactgggaggaggaggagaaggaagaggacgaggaagatgatgac
acgaaggagaacgacatctcctactttacactgaacaaccttcattccgcctatggtaca
cggccaccattgccagtggcctttcaactcagcgacgattacaactgcgtcgtggagctg
ttttatctgtgcacaaatgctctcagcgaggatcgtccagcggccaagaccatttggcag
tgcctggagaacaatggcgcaaatgttgcgacagaaagcgattag

DBGET integrated database retrieval system