KEGG   Drosophila simulans: Dsimw501_GD17463Help
Entry
Dsimw501_GD17463  CDS       T01065                                 

Gene name
Dsim_GD17463
Definition
(RefSeq) GD17463 gene product from transcript GD17463-RB (EC:3.1.26.5)
Organism
dsi  Drosophila simulans
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 148 aa AA seqDB search
MFKLSELVRWLGLTEFEILVNLCGLLVFTITLAVKLHLQARAGPGGILPEPMGDWFTVFS
PLFFIDICNAYFCVIVGIRMYLDSNNKRKALHRFMWSTYFLVLIAIFKYLLCLKLSSKTG
LEYSEVFSPIFVLLQLVAVRACQLPNSI
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaactctcggagctggtgcgctggctggggctcaccgagttcgagatcctggtc
aacctgtgcggcttgcttgtgttcaccatcacgctggccgtcaagctccatctgcaggcc
agggccggacccggcggcatactcccggagcccatgggcgactggttcaccgttttcagc
cccctgttcttcatcgacatctgcaacgcgtacttctgcgtcattgtgggcattcgcatg
tacctggactcgaacaacaagcgcaaagccctgcatcgcttcatgtggagcacgtatttc
ctggtgctcatcgccatcttcaagtacctgctctgcctgaagctatccagcaagacgggc
ctcgagtactcggaggtcttctcgccaatcttcgttctgctgcagcttgtggctgtgcgc
gcctgccagttgcccaactccatctga

DBGET integrated database retrieval system