KEGG   Drosophila simulans: Dsim_GD17463Help
Entry
Dsim_GD17463      CDS       T01065                                 

Definition
GD17463 gene product from transcript GD17463-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dsi  Drosophila simulans
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dsi03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:dsi03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 166 aa AA seqDB search
MGSNHPEHGTKPRSTKHHKQQNHRVVRKQPPRPAVSDRHNIYITSKTDFKAQQRRCEELI
NSGVHEIFLHCMGFSVTRGLNIALRLVQNSEGALSYAINTSTVQLVDELHPLCDAEDITF
RQRNNSALHIKISNNSLFDIVVPQPSQSQTQAQSLGQFRGKPKARQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcaatcatcccgagcacgggaccaagccgagatccaccaaacaccacaaacaa
cagaaccaccgagtggtgcgcaagcagccgccgcgccccgcagtcagcgaccgccacaac
atctacatcaccagcaagacagacttcaaggcccagcagcgccgctgcgaggagctgatc
aactccggggtccacgagatctttctgcattgcatgggcttctccgtcacccgcggcctc
aatatcgccctgcgcctcgtccagaattctgaaggcgccctcagctacgccatcaacacc
tccaccgttcagctggtggacgaactgcaccctctgtgcgatgccgaggacataaccttc
cgccagcgcaacaactcggccctgcacatcaagatctccaataacagtctcttcgacatc
gtcgtgccgcaaccgtcgcagtcccagacgcaagcccagtccctgggccagttccgaggc
aagccgaaggccaggcagtag

DBGET integrated database retrieval system