KEGG   Drosophila simulans: Dsim_GD17470Help
Entry
Dsim_GD17470      CDS       T01065                                 

Definition
GD17470 gene product from transcript GD17470-RA
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsim_GD17470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1318 aa AA seqDB search
MDGITEDMWTPYKHLYSVFQTTVSNGSSYTADLEQCLKKYKPSFTNLLRNPARSEKSRNL
LRSALNEGVPIQAQSRKLMISQDLADEAVILSDMFDLDEVFAVELLCTAQRQQKHHPGLS
RGLVAVLLYYDGRKAISCTLRDIFQVVSGVSWNTELPKEITGLVTNYAEGLVDGSNILGR
LLELLDEMDVDKEFAMLTTNRAFGSKKHQNQVLGLYEDIQQALAMALFNWSAQRGLPRHI
AIRLLRQLASRRNHDAGGIMDDVTLIMLMALLYAYDTSILLIAEDINEHTDRLPIFSDHK
FAECFLEELYAQGSWQAPRLNAIIAYSFGLTLASLRHAPAQLQATTISTINRDEMLIDEA
LGAQVFVFLHSLLLEKDMVYSTEFFYRRVHLLITDFIDFMNSKVTELRGRADESSHTIIS
FLNEGLEPPPNLDTNFELLMLCVAKMHGDPRVTIRLCDEYWGPGEPTNCTAYKNTSRSVS
LFKFISLASELLPQTLFKSYLKMISGLTRTDFSARCAFNMLRVHQMATGGQYAVSWDHFF
TTLGNYYTSMRNDFHTNIGMSGETFYRTRSTPKAITQREAEHLVAVMGIIQAVAEHDEVS
RIMICEQPNWQTPQVLLGLVACATPLLLKAEILQTLLQLKSEMLQLLLSIVEDVRERLDE
YNRFQGKELLEECSLYALLLLEAALAKQNAFFEAHSAANCPILLMGLNRMLLDVNPRSRK
PDHVLNIIKYVTYNSWLPRHALAAIKILASVTQLPNVSTQILSMYGQGSNEKLEIRQGFV
ECLEMEVCAGRHDDELLDQLALNNHVPYLGFSDELDTEREVSGERECTTVESPLELQAGE
GGLESKPASIELQLKEAIIKLFEMNLSQQLPNFVYFLLGVDVLREFMANGRQHLGIEMQS
SCVNSVVLLLEKYLDALGVLSNMKVYDLQPDVKASELNRNEPQNFLPSIDERFRSILLPA
LSLCDAIINSLGPRNNSAALQVLNFLFAHIDMVEAMLRSATPYMDLGHLEQVAVISSLFA
RASRHDLTVLEDSVKLELRNRLGRVQQLMIVVFGRFCVSEPTIRRMLQQDQDQQTNPTED
AKRLRVKYFLDIAANVSLYCRNVVTSHSKTSMTSKYLLTTVINDVTLLTGKIASKKLTAI
LHTILNQLKGSIGHYLSQKSIADNLLQQRASLPNISFGPNGKQSYLELSQRYNEKHSELR
QSVFIAEQNLYLLWIHLDFYMRNTIDYANENRNTINESNMDDDGNDVSVLNASQDEILQL
KQLLISTFNETFCTQLMTASEEYSIKCKGFNASLLRRIKSLVQFAPITANDFTSSFNS
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atggacggcataaccgaggacatgtggacgccgtacaagcatctgtacagcgtttttcag
acgacggtgtccaatggcagtagctacaccgcggacctggagcagtgcctcaagaagtac
aagcccagcttcaccaacttgctgcgcaatccggcgaggagcgagaagagccgcaaccta
ctgaggagtgccctgaacgagggcgtcccgatccaggcgcaatcgcgaaagctaatgata
tcacaggacctggctgacgaggcggtcattctgtccgacatgttcgacctggacgaggtg
ttcgccgtggagctgctgtgcaccgcccagcgccagcagaagcatcatcccggcctgtcc
agaggccttgtcgctgtgctgctctactacgacggacgaaaggccatcagctgcaccctt
cgcgacatcttccaggtggttagcggcgtctcctggaacaccgagctgcccaaggagatc
accggactggtcaccaactatgccgagggccttgtcgacggctccaacatactgggacgc
ctgctggagctgctcgatgagatggatgttgacaaagagttcgctatgctgaccacaaac
cgcgcgttcggctccaagaagcaccagaaccaggtgctgggcctgtacgaggacattcaa
caggcattggcaatggccctgttcaattggtcggcgcagcgcggcctgccgcgacacatt
gccattcggctgctgcgccagttggccagccggaggaaccacgacgcgggcggcatcatg
gacgacgtgaccctgatcatgctgatggctctgctgtatgcgtacgatacctccattctg
ctgatcgccgaggacatcaatgagcacaccgaccgccttccgatcttcagcgatcacaag
ttcgccgagtgcttcctggaggagctgtacgcgcagggcagctggcaagcaccgcgcctc
aatgccatcattgcctacagcttcggactcacgctggccagcctgcggcatgcgcctgct
cagctccaggccaccaccatatcgaccatcaatcgcgatgagatgctcatcgatgaggca
ctgggagcgcaggtattcgtcttcctgcacagcttgctgctcgaaaaggacatggtctat
agcacggagttcttctaccgccgcgtccatctgctcatcacggacttcatcgacttcatg
aactccaaggtgacggagctgcgcggccgggcagacgagtcgtcacacacgatcatcagc
ttcctgaacgagggtctggagccgccgcccaacttggacaccaacttcgagctgctcatg
ctgtgcgtggccaagatgcacggcgatccgcgcgtcaccatcaggctgtgcgacgagtac
tggggccccggcgaacccaccaactgcacggcgtacaagaacacctcgcgctcggtgtcc
ctgttcaagttcattagcttggccagcgagctgctgccacagacgctgttcaagtcctac
ctcaagatgatatccggactcacacgcaccgatttctcggcccgctgcgccttcaacatg
cttagggtgcaccagatggccaccggcggccagtatgcggttagctgggatcacttcttc
acgaccctgggcaactactacacttcgatgcgcaacgacttccacaccaacatcggcatg
agcggcgagaccttctaccgcacccgatcgacgccaaaggccattacgcagcgagaggcg
gagcacctggtggccgtaatgggcatcatacaggcggtggcggagcacgacgaggtctcg
cgcatcatgatctgcgagcaacccaattggcagacgccgcaggtgctcctgggcctggta
gcgtgcgccacgccgctgctgctcaaggcggagattctgcagacgctgctgcagctgaag
tccgaaatgttgcagctgctgctgtccattgtggaggatgtgcgtgagcggctggacgag
tacaaccgcttccagggcaaggagctactcgaggagtgctccctgtacgcactgctgctc
ttggaagccgcgctggcgaagcagaacgccttctttgaggcccactcggcggccaactgc
cccattttgctgatgggcctgaaccgcatgctcctggatgtgaatccacgcagccgcaag
cccgatcacgtgctgaacatcatcaagtatgtgacctataatagctggctgccgcgccac
gccctggccgccatcaagattctggcttcggtcacccagctgccgaatgtctccacccag
atcctcagcatgtacggccagggcagcaacgagaagctcgagatccgtcagggtttcgtc
gagtgcctggaaatggaggtgtgcgcgggcaggcacgacgacgagttgttggaccaactg
gcccttaacaatcacgttccgtatctgggcttcagcgatgagctggacactgagcgagag
gtgagcggggaacgcgaatgtacaactgtggaatcgccactggagctgcaggcgggagag
ggcgggctggagagcaaaccggccagcatcgagctgcaactgaaggaggccattatcaag
ctgttcgagatgaatcttagccagcagttgcccaactttgtgtacttcctgctcggcgtg
gacgtgctgcgcgaattcatggccaacgggcggcagcacctgggcatcgagatgcaaagc
tcgtgcgtgaactccgtggtgctgttgctggaaaagtacctggatgcgctgggcgtgctg
tcgaatatgaaggtctacgacctgcagcccgacgtgaaagccagcgagctgaatcgtaac
gagccgcagaacttcctcccgtccatcgatgagcgcttccggtcgatcctcctgccggca
ctgagcctctgcgatgccattatcaactcgctgggcccgcgcaacaactccgccgccctg
caggtgctcaacttcctgttcgcgcacatcgacatggtcgaggccatgttgcgctcggcc
acgccgtatatggacctcggccacttggagcaggtggcggtcatcagcagtctgtttgcc
cgcgcctccaggcacgacttgaccgtgctggaggacagcgtgaagctggagctgcgcaat
cgcctgggccgcgtgcagcagctgatgatcgtggtgttcggacgcttctgcgtaagcgag
cccaccattcggcgcatgctgcagcaggatcaggatcagcagaccaaccccactgaggac
gcgaagaggctacgtgtcaagtatttcctggacatagcagccaacgtgtcgctctactgc
cgcaacgtggtcaccagccactcgaagacgagcatgacctccaaatacttgctgaccacc
gtgatcaacgatgtgacgctgctcactggcaaaatagccagcaaaaagctgacggccatc
ctgcacaccatcctcaaccagctgaagggctccatcggccactacctctcgcagaagtcg
atcgccgacaatctcctccagcaacgcgcctccctgcccaacatcagctttgggcccaac
ggtaaacaaagctacctcgaactgagccagcggtacaacgagaagcacagcgaactgagg
cagtccgtcttcatagccgagcagaacctgtatctgctgtggatccatctggacttctat
atgcgcaacaccatcgactacgccaacgaaaacaggaacaccatcaacgagagcaatatg
gacgacgacggcaacgacgtgtccgtgctgaacgcgtcgcaggatgagatcctgcagctc
aagcagctgctcatctccacattcaacgagaccttctgcacgcagctaatgaccgccagc
gaggaatactcgatcaagtgcaagggcttcaacgcctcgctcctccgccgcattaagtcg
ctcgtccagttcgcccccatcactgccaacgacttcacttccagcttcaattcgtag

DBGET integrated database retrieval system