KEGG   Drosophila simulans: Dsim_GD17542Help
Entry
Dsim_GD17542      CDS       T01065                                 

Definition
GD17542 gene product from transcript GD17542-RA
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dsim_GD17542
Peptidases [BR:dsi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsim_GD17542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 398 aa AA seqDB search
TLARSGTGSSSTARSVLPPMTPTSSRYWDRDSGTSRSSIGTSSALNSSSLKHNLDDGYKS
ASSSRDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKDQQILHE
FAKLIHEMWTSNVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVK
GETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWD
LSVPLPSSSRCKLDACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHL
KRFSETRWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALC
KHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYERT
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
acgttggcgagaagtggcactgggagtagcagcactgcccggagcgtcctgcctcccatg
acgcctacgtcaagtcggtactgggatcgggacagcggcaccagccgcagcagcataggc
acctcctccgcactgaactcgtcatccctgaaacataacttggatgatggctacaagagc
gcctcctcttcgcgggatgagaagtccgaaggtctgtgcggtctgcgaaacattgggaac
acatgctttatgaactcggtcatccagtgcctgagtcacactcaagagctgacccgcttc
ttgcggtcgcaccacggctctcgctcgttatccaccaaggatcagcagatactccacgaa
tttgccaaactcattcacgagatgtggacctctaacgtgcacactgtgacgcccatggag
ctaaagagggcgttctcgaccaaacatcgcatgtacagcgactacaaccaacaggatgcg
caggagttcctgcgttttttccttgactcgctgcattcggccctcaattcgggcgtcaag
ggtgagacgctcaacattgacgataatctcagtgacaataaaaaggcggacttgacctgg
gagtggtatacgcggcacgagaactctttggtgcgcgacctatttgtgggtcagctcaaa
agcacactgaagtgcaccacctgcggcaacaccagcgtcaccttcgatccgttctgggat
ctgagcgtaccgttgccgtcttcttcccgctgcaagctagatgcttgcctcgacctcttt
atccgcgaagaggtccttgacggcgacgaaatgcccacgtgcgccaagtgcaagacgcgg
cgaaaatgcaccaagagcttcaccattcagcgtttccccaaatatctggttatacaccta
aaacgcttttcggagacacgctggagcaagctgtccaacatcgttgaatttcccacatca
gacagcgagctgaacatgggctcctatggcgccaactccaactcgaatgtgcattactcg
ctttatgcgatatctaatcatatggggtcaacggctggtggtcattatgttgccctttgc
aagcatccagtttcccgcaagtggcacgaatttaatgataatatagtcagcgatgccttg
tccgaaaaccatcttgtttcatccagtgcctatattcttttctacgagcgtacgtaa

DBGET integrated database retrieval system