KEGG   Drosophila simulans: Dsim_GD18002Help
Entry
Dsim_GD18002      CDS       T01065                                 

Definition
GD18002 gene product from transcript GD18002-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dsi  Drosophila simulans
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dsi03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dsi04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 200 aa AA seqDB search
MENSRQSKESSELERGTSVDDYKLASLGATNKHQLQNTWTLWGVNYDPEIPWEDMLKEID
SFDTVEDFWNLYFSIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTNGVDKRFSAE
LDKIWLDVLLCIIGEACDHCDQICGALVRIRKNINKVSVWTKADAGDEAIREIGHKLSCE
VLNLKGKKNWIFFPHGSQEG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggaaaactcaaggcaaagcaaagaatcgtcggaattagaaagggggacttctgtggat
gattacaaacttgcatcgttaggtgccacaaacaagcaccagctgcagaacacatggacc
ctgtggggcgtaaactacgatcccgaaataccgtgggaggacatgctgaaggagattgac
agcttcgataccgtcgaagacttctggaacctgtatttcagcatcgatacgccatccaag
ctcaaccgcggctgtgattacatgctcttcaagaagggcattcgccccatgtgggaggat
ccgccgaacaagggcggaggtcgttggacaaacggtgtggataaaaggttctcagccgaa
ctggacaaaatttggctggacgtgcttctttgcattattggcgaggcctgcgatcactgc
gatcagatctgtggggctttggtcaggattcgcaaaaatatcaacaaagtctccgtatgg
acaaaggcagacgctggcgatgaggccatccgggagattggtcacaagctgagctgtgag
gtcttgaacctcaaagggaaaaaaaattggatattctttccgcatgggtcccaagaaggt
tga

DBGET integrated database retrieval system