KEGG   Drosophila simulans: Dsim_GD18123Help
Entry
Dsim_GD18123      CDS       T01065                                 

Definition
GD18123 gene product from transcript GD18123-RA
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Dsim_GD18123
Peptidases [BR:dsi01002]
 Serine Peptidases
  Family S8: subtilisin family
   Dsim_GD18123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 654 aa AA seqDB search
MAAATWSWLLAPFLLLHWASAGAGGGAGGAGAGLSGPAVFTSSFLVRFRRGVDNAFAHDV
ADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRV
KRGLRPAVPAIHGMKFDLKVGEGNRIDEEPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAA
WAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTR
CAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGP
TDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISI
NSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAG
VFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAG
AMVTLSKQWHAVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKGTDTEVNYLEHVQAV
ISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKL
EARFNSPQTRHGNLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVKKAHEDKKMK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccacatggagctggctgttggccccattcctgctcctccactgggccagt
gcaggagcgggcggaggagcaggcggcgcgggagcgggtctgagcggccccgccgtcttc
accagctccttcctggtgcgcttccggcgcggagtggacaacgcgttcgcccatgatgtg
gccgacaagtacggcttcgacaacctaggcccgctggtcggcgccgatggacacgagtat
catttcaagcaccggacccttccacatgcccgctccaggcggagtctgacgcacacacgg
gccctcaagagccatccggcggtgcatacggccgtgcaacagccgggattcaagcgggtt
aaacgtggcctgcggccggcggtgcccgccattcacggcatgaagttcgacctgaaagtg
ggcgagggcaatcggattgacgaggagcccactgacccctacttccccatgcagtggtac
ctcaagaacacgggtcagaatggcggcaaagtcaggctggatctgaatgtgcaggccgcc
tgggcccagggaatcaccgggaagaatgttacgacggccatcatggatgatggcgtggac
tacatgcatccggatctgaaattcaattataacgccgaggccagttatgacttcagcagt
aacgatccctttccgtatccccgatacaccgacgactggttcaacagccatggaactcgt
tgtgccggcgaagtggctgctgccagagataatggaatttgcggcgtgggcgttgcttat
gacagcaaaatcgcaggcattcgcatgctggatcagccgtacatgacggacctaatcgag
gccaactccatgggccacgagccgcacaaaatccacatatacagcgcctcctggggtccc
accgatgatggcaagaccgtggacggtccccggaatgccaccatgcgagcgatagtccag
ggcgtcaatgagggtcgaaatggcctgggcaacatctatgtttgggcatccggcgacggc
ggcgaggaggatgactgcaactgcgacggctacgccgcctccatgtggaccatttccatt
aacagcgccattaatgacggccagaacgcccactacgacgagagctgcagctccacgctg
gcgtccacattcagcaacggagccaaggaccccaacacgggcgttgccaccacggacctc
tatggcaagtgcacgaccacccactcgggcaccagtgcggcggcgcccgaagcagcgggc
gtctttgccctggccttggaggccaatccgcagctgacttggcgggacatacagcatctg
acggtgctgacatcgaagcgcaactcgctgttcgatgccaagaaccgattccactggaca
atgaacggcgtgggcctggagttcaaccacctattcgggttcggagtactggacgccggc
gccatggtcacactctccaagcagtggcatgcagtgccaccgcgctatcattgcgaggcg
ggcgagcttacccagccacaggccattgtaatgggtcgttcgctcttctgggagatcaaa
accgatgcttgcaagggcaccgatacggaggtcaactatttggagcacgtgcaggcggtg
atctcggcaaatgcatcacgacgcggtgatcttgagctgttccttacatcaccaatgggc
accaaatccatgatcctgtcgagacgcgccaacgatgatgaccaccgcgatggcttcacc
aaatggcccttcatgaccactcactcgtggggcgagtatccgcaggggacctggaaactg
gaggctcgcttcaactcgccccaaacccgacacggcaatctgctggaatggtccttggtc
ctgcatggcaccaaggaggcgccataccgcaccctgcacccctcgtcaccgcactccaag
ctggccattgtgaagaaggcgcacgaggacaagaagatgaagtag

DBGET integrated database retrieval system