KEGG   Drosophila simulans: Dsimw501_GD18277Help
Entry
Dsimw501_GD18277  CDS       T01065                                 

Gene name
Dsim_GD18277
Definition
(RefSeq) GD18277 gene product from transcript GD18277-RB (EC:1.3.3.4)
  KO
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dsi  Drosophila simulans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dsimw501_GD18277 (Dsim_GD18277)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dsimw501_GD18277 (Dsim_GD18277)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 475 aa AA seqDB search
MSTAVLGGGLSGLSAGYYLLRRFGKPLTIYEASPRVGGWVRSENRKDRNFIFESGPRTIR
PVGEPGANTLELVEELKLEVTPIRRSHVAARNRMLYAKGQLCMLPNSPKGLFGVLPPFTK
PLYKALLQDLFTASKKAKLEDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVRF
LMEGLFEKEQKYGGVLKGTLISRFEKNKTKDTKDGLFAEGQPKLYAQAVKEKWAMYGLQG
GLENLPKTMRKYLGERDVNVQLSNECRNLTFSSSGVRMNIKDAEVPVEHVVSSLPAYKLA
PLVKQQHPSLSAQLLSIPYVDVLVVNMQFPGKLLKQDGFGLLVPPVEKLPLLGVIFDSCC
FDMGENTVLTVMMGGHWFDQWFGDRPSPKQILDLATSHVQKMLQIREEPKFSRVHTLHKC
IPQYTVGHKRRVEAIRNYIKTYKLPLSVCGAAYDGVGINDVILSARRQVEAIPLS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggccgtgctgggaggcggactgagtggactgtccgccggatactacctgttg
cggcgattcgggaagccgctgaccatctacgaggcctcgccccgtgtgggcggatgggtg
cggtcggagaatcgcaaggatcgcaacttcatcttcgagagcggaccgcgaaccatacgc
ccagttggagagccaggtgccaatacgctggaactggtggaggagctgaagctggaggtg
actcccattcgacgcagtcatgtggcagcacgcaaccgaatgctgtatgccaaaggacag
ctctgcatgctgcccaacagtcccaagggtctctttggcgtcctgcctcccttcacgaag
ccgctgtacaaagcgctgctccaggatctgttcacggcaagcaagaaggccaagctggag
gatgagagcatctacagtttcgctgagcggcggtttggtaaggagatagccgactacgcc
ataagtcccatgatctgtgggatttgcgccggtgacgcgcgagaaataagcgtgcgcttc
ctgatggagggactctttgaaaaggagcagaagtacggaggagtgcttaagggcacactc
atttcccgctttgaaaagaacaagaccaaggacaccaaggatggactatttgccgaggga
cagcccaaactgtatgcgcaggcggtgaaggagaagtgggccatgtacgggcttcaaggc
ggtctagagaacctgcccaaaactatgcgaaagtatctaggcgagcgggatgtgaacgtg
cagctaagcaacgaatgccggaacctgaccttcagcagctctggggttcgaatgaacatc
aaggatgccgaagttccagtggagcatgtggtcagctccctgcccgcctacaaactggcg
cccctggtaaagcagcagcatccctcgctgagcgcccaacttttgagcatcccgtacgtg
gatgtgctggtagtgaacatgcagttccccggcaagctactcaagcaggacggatttgga
ttgctagtaccgccagtagaaaagttgcctctgctgggcgtcatcttcgacagctgctgc
ttcgatatgggcgagaacactgtgcttaccgtgatgatgggtggtcattggttcgaccag
tggttcggcgatcgtcccagccccaaacagattctagacttggccaccagccatgtgcag
aaaatgctgcagatccgcgaggaacccaaattcagtcgagtgcacacactgcacaagtgc
atcccgcagtacactgtgggccacaagcggcgcgttgaggccattcggaactacatcaag
acttacaaactgccactgtctgtctgcggagctgcatacgatggcgtgggcatcaacgat
gttatcctgtccgcccggcgacaagtggaggccatacccttgtcctaa

DBGET integrated database retrieval system