KEGG   Drosophila simulans: Dsim_GD18318Help
Entry
Dsim_GD18318      CDS       T01065                                 

Definition
GD18318 gene product from transcript GD18318-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dsi04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 366 aa AA seqDB search
MSVSITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKALVRGTNMHVAIKKLARPF
QSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANASLENFQQVYLVTHLMDADLNNI
IRMQHLSDDHVQFLIYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKR
ITAEEALSHPYLEKYAEPSVEQTSPPYDHSFEDMDLPVDKWKELIYKEVTNFKPPPSFAQ
VLKDVK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgtccattacaaaaaagttttacaagttggatataaaccgaacggaatgggag
atcccggatatatatcaggatctgcagcccgtgggatcgggagcttacggacaggtgtcg
aaggcacttgttcgtggcaccaatatgcatgtggccattaaaaagcttgccaggcctttt
caatccgccgtccatgcaaagaggacgtaccgggaacttcgacttttgaagcatatggat
catgagaacgtaatcggcctgctggacatattccatccccatcccgctaatgcatcgctg
gagaacttccaacaggtgtacttggtaacccacttgatggacgcagacctgaataacatc
atacggatgcagcacttgtccgacgaccacgtccagtttttaatctaccagatactccgt
ggcttaaagtatatccacagtgccggagtgatccaccgtgatcttaagccctcaaacatt
gccgtcaacgaggattgcgagctgcgcattctagacttcgggctggcccgtccaacagag
aacgagatgacaggctatgtggccacgcgttggtaccgcgcacctgaaataatgctcaat
tggatgcactacgaccaaacggtggacatctggtcggtgggctgcatcatggccgaacta
attaccagacgcaccctcttcccaggcaccgatcatattcaccagctaaacctgattatg
gagatgttgggcacgccacccgccgaatttttgaagaagatctcatcggaaagtgcacgt
tcctacatccagtcacttccgcctatgaagggacgaagttttaaaaatgtttttaagaac
gccaatccgctggccatcgatttgctggaaaagatgttggagttggatgccgagaagcgg
atcacagccgaggaggctctttcacatccctatctggagaagtatgcggagcccagcgtc
gagcagacctcaccaccatacgatcacagcttcgaggatatggatttgcccgtagacaaa
tggaaggagctgatctacaaggaggtcaccaactttaaacccccaccatcgtttgctcag
gttctaaaggatgtaaagtga

DBGET integrated database retrieval system