KEGG   Drosophila simulans: Dsim_GD18319Help
Entry
Dsim_GD18319      CDS       T01065                                 

Definition
GD18319 gene product from transcript GD18319-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dsi  Drosophila simulans
Pathway
FoxO signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsim_GD18319
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsim_GD18319
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dsim_GD18319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 347 aa AA seqDB search
MSEFVKVAVNERLWEFPDIYEFVCFLGGGSFGQVAKVRLRGTENYVAMKRLMHPFEREED
AKGAYREIRLLKHMNHRNVISLLNVFHPPAHNMMDFQQVYLVTHLMDADLHRYSRSKKMS
DHEIRIILYQILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADKMTDYV
GTLWYRAPEIIFLRGQYTKAIDVWSVGCILAELITGRVLFPGENYPNQIRCLIDIIGTPT
REFITGISMEKSRSYLERYPLRQRCDFHHLFMGTDVQAVDLMEKMLEIVPEKRITAAEAM
LHPYLRDLIEPHHHAEDTAPVYDQNFENLVLPVKCWKELVANEIRNF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagttcgtgaaagtggcagttaacgaacgcctttgggagttccccgacatatac
gagttcgtttgttttctgggtggcggttcctttggccaggtggctaaggtgagactacga
ggcaccgaaaattacgtcgctatgaaaaggcttatgcacccattcgagagggaggaggat
gctaagggtgcctatcgcgagatccgtctgctgaagcatatgaatcatcgaaatgttatc
agcctgctgaacgtcttccatccaccagcgcacaacatgatggattttcagcaggtttac
ttggtgactcacctgatggacgcggacctgcacaggtactcgcgttcgaaaaagatgagc
gatcatgagattaggataatcctttaccaaatactgcgggggctgaagtacatacacagt
gccggggttgttcatcgtgacttgaaaccctgcaatatcgcagttaatggaaatagcgag
gttcgcatacttgacttcggtttatcccgtatgtgcgcagacaaaatgacggactatgtg
ggaactctgtggtatcgagctccggaaattatcttcctcaggggtcagtacacaaaggca
atcgacgtgtggtcggttggttgcattctggcggaacttatcacggggcgtgtcctgttc
cccggtgaaaactatccaaaccaaatacgatgtttgattgacataatcggtactccgacg
agggagtttatcaccggaataagcatggaaaaatcgcgtagttacctggagaggtacccg
ttacgccaaaggtgtgattttcaccacctatttatgggtaccgatgtccaggccgtcgat
ttgatggaaaaaatgctcgaaattgttcccgaaaaacgcataacagctgcggaagcaatg
ctccatccataccttcgggatcttattgagccacaccatcatgccgaagacaccgcacca
gtctatgatcagaacttcgaaaacctagtgctgcctgtaaaatgctggaaggaacttgtt
gccaacgagattcggaacttctga

DBGET integrated database retrieval system