KEGG   Drosophila simulans: Dsim_GD18325Help
Entry
Dsim_GD18325      CDS       T01065                                 

Definition
GD18325 gene product from transcript GD18325-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dsi  Drosophila simulans
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsim_GD18325
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsim_GD18325
Translation factors [BR:dsi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dsim_GD18325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 223 aa AA seqDB search
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQHTYCLWFSRKE
TQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIVPMWEDPANS
KGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPEDSLAVWHRTATDM
TSTTRIRDTLRRILNIPLTTAMEYKIHCDSLKYVSNNKGPLKS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagaaagtagccaacaagcagtacgagacgaaaaactggccagatatcgtc
gacagcgacgacagcgatgtggataacgagatagatgtggacaacctgccgccactggag
gtgggtcccggcgagaaccggctgcagcacacatactgcctctggttctctcgcaaggag
acgcagcgggcggccgccgactacagcaagtcgctgcacatggtcggccggtgcgccagc
gtgcagcagtggtggtcgctctactcgcacctcatccggcccacagccctgaagccctac
cgggagctcctcctcttcaagcagggtatcgtgccgatgtgggaggacccggcgaacagc
aagggcggacaatggttgatacggctgcgcaagaacaaggtcgaccgggcctgggagaac
gtttgtatggcgatgctcggggagcagttcctcgtcggcgacgagatatgcggagtcgtg
ctacagacgaaatatccggaggatagcttagcagtatggcaccggactgccactgatatg
accagtacaacacgtatccgtgatacgttacgcaggatattaaatatacctctaacaacg
gcaatggagtataagatacactgtgatagccttaaatatgtttcaaataataaaggccca
ttgaaaagctga

DBGET integrated database retrieval system