KEGG   Drosophila simulans: Dsim_GD18651Help
Entry
Dsim_GD18651      CDS       T01065                                 

Definition
GD18651 gene product from transcript GD18651-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dsim_GD18651
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dsim_GD18651
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dsim_GD18651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 604 aa AA seqDB search
MPARCGCLKKEARVHVIYVGGTIGMIRNESGALHTEPKVLARQLQEFPSCHDRNYTSKDN
DGPMMVLPAVSGAPYRVLYDLVEFCPLMDSSCMGFCDWKRIANEVGKTYKSYDGFVILHG
TDTLAYSASALAFMLESLNKPVVFTGAQIPIFEARSDGRENFLGALLIAGNYNIPEVLVF
FGNKILRGCRSTKLSSDSFHALDSPNFAPLGRASVNIEINSRQIFRPCNIKPFSLHSELE
KNVALLRIYPGMSASVVQAILKEPTKGVVLQTFGAGNFPVNREDLMDELREAVHRGVIIV
NITQCSAGMVANIYETSQGLMEVGVIPGYDMTQEAAFTKLAYVLSKPEWDIPNKKKVMLL
SLRGELTTNKVAKINDIDLIEGVARTLHMSTAMERQQMCSTFYPALVAAAVTEGDVHKLG
DLKQYGANLCDTNCDGRSAMHLACFLGKLNCVCFLISAGCPVNVHDRFNRTPLHEAIDTD
NHDIIKALLKNGAKLNDQPLVQAELLRALTERGKIKRLESFRLAGANLTLADRTGRTALH
YACQLGNHEVVDYLLPHYENPYIKDELGMSPIDYAKAANHAHILTLMRFKEKELAKQDPC
SCTQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgaggtgcggttgcttgaagaaggaggctcgcgtccatgtcatctacgtgggt
ggaaccatcggaatgatccgcaacgagtccggagcactgcacaccgagcccaaggtgctg
gctcggcagctccaagagtttcccagctgccacgacaggaattacaccagcaaggataat
gatggtcccatgatggtgctacccgcagtgtctggagctccgtatagagtcctttacgat
ttggttgagttctgcccactgatggactccagctgcatgggcttctgcgactggaagcgc
attgccaacgaagtgggaaagacatacaagtcctacgacggctttgtgatcctccatgga
acggataccctggcctactccgcctcggcactagcgttcatgctggagagcctgaacaaa
cccgtggtattcactggggcacagattccgatctttgaagcccgcagcgatgggcgggaa
aacttcttgggcgcacttctcatagcaggcaattacaatatacccgaggtgctggtcttc
ttcggcaacaagattctacgtggctgtcgctccacgaagctcagttccgactcctttcac
gcactggactcaccaaattttgccccattgggtcgggcgagtgtcaacattgagataaac
agccgccaaatctttcgaccgtgcaatattaaaccattttcacttcattcggaactcgaa
aagaacgtggcgctgctgcgaatttacccgggaatgagtgccagtgtggtccaggcaatc
ctgaaggagccaacgaaaggtgtggtcctccagacctttggagccggcaattttccggtt
aatcgtgaggacttgatggacgaactgagggaggcggttcacagaggcgttattattgtc
aacatcacgcagtgctcggcgggcatggtggccaacatttacgagacaagccagggcctg
atggaggtgggcgtaattcccggctacgatatgactcaggaggccgcctttaccaagctg
gcctatgtgctgtccaagccggagtgggacattcccaacaagaagaaggtgatgctacta
agtttgcgcggcgagctgaccactaataaggttgccaagattaacgacattgatctgatc
gagggcgtggcccgcacattgcacatgtcgacggcgatggaacggcagcagatgtgctcc
acattctatcccgctttggtggcggccgcggtcaccgaaggtgatgtccacaagttaggc
gatcttaagcagtacggcgccaatctgtgcgacaccaactgcgatggtcgctccgccatg
cacctggcctgcttcctgggcaaactaaactgtgtttgcttcctgatttccgccggctgt
ccagtaaatgtccacgatcgattcaaccgcacgccattgcacgaggccatcgacacggac
aaccatgatataatcaaggcgctgctaaagaacggtgccaagctaaacgatcagccgctg
gtccaggcggagctactgcgtgcccttaccgaacggggcaagatcaagcgattggagtca
tttcgtctggccggagccaatctcacgctggccgatcggactggacgaacggctctgcac
tacgcctgccagttgggcaatcacgaggtggtggactatctgctgccgcactacgagaat
ccctacataaaggatgagctgggcatgtcgccaatcgactacgccaaggcagccaatcat
gcccacatcctgaccctgatgcggttcaaggagaaggagctggccaagcaagatccgtgt
tcctgcacgcaatag

DBGET integrated database retrieval system