KEGG   Drosophila simulans: Dsim_GD18745Help
Entry
Dsim_GD18745      CDS       T01065                                 

Definition
GD18745 gene product from transcript GD18745-RA
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dsi  Drosophila simulans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsim_GD18745
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsim_GD18745
  Amino acid metabolism
   00310 Lysine degradation
    Dsim_GD18745
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dsim_GD18745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 468 aa AA seqDB search
MTGIISIVTRRLPQTLGMRALRSNEVKRCIRQYSRLVACAAQQQQLLRQDGSNRCQEATR
LLTWQGIHTTSSMWSEQTVNVPPFADSIAEGDIKFTCKVGDSFAADEAVMEIETDKTTVA
VPAPFSGTLTDILVKDGDTVKPGQALFKIKPGAAPAKAAAPAAAPAPAAPKAAPAPAAAP
KPAPPPPAAGAPKPPPPPPPKAAPRPPPPAPVAALKPAVAQVKVPPADGSRQILGTRSEQ
RVKMNRMRLKIAARLKDAQNTCAMLTTFNEIDMSYAMDFRKQNLDAFTKKYGIKFGFMSI
FAKASAYALQDQPVVNAVIDGTDIVYRDYVDISVAVATPRGLVVPVIRNVEGMNYADIEI
ALAGLADKARRDAITVEDMDGGTFTISNGGVFGSLMGTPIINPPQSAILGMHGIFDRPIA
VKGEVKIRPMMYIALTYDHRIIDGREAVLFLRKIKAAVENPAIIVAGL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaataatttcgatcgtaacgagacggctgccccaaactttgggaatgcgagcc
ctgcggagtaatgaggtaaagcgttgcatccgccaatattctcggttagttgcctgcgcc
gcccagcagcagcagttgctccgtcaggatggatcgaatcgctgccaggaggccaccagg
cttctcacctggcagggtatccacaccacgtcgagcatgtggtcggagcagaccgtcaat
gtgccaccctttgcggactccattgccgagggtgatatcaagtttacttgcaaggtgggt
gactcattcgccgctgacgaggctgtcatggaaatcgagaccgacaagacgacggtggct
gtgccagctcccttctccggaactctgaccgacattctggtgaaggatggcgacaccgtc
aagcccggccaggctctgttcaagattaagcccggtgcagcgcccgccaaggcagctgct
ccagcggctgctcctgcgcctgctgccccaaaagctgccccagctcccgctgctgcaccc
aagccggcacctccaccacctgccgccggcgcaccaaagccaccaccaccgccaccacca
aaggcagcccctcgaccaccaccacctgctccagtggctgcactcaagccggccgtcgcc
caggtgaaggtgccaccagcggacggatcgcggcagatcctaggcactaggtccgagcag
cgtgtcaagatgaaccgaatgcgtctaaagattgccgcccgcttgaaggatgcccagaac
acatgtgctatgctcaccactttcaacgagatcgatatgagctatgccatggacttccga
aagcagaatctggatgcgttcactaagaagtatggtattaagtttggattcatgtcgatc
ttcgcaaaggctagtgcctatgcgctgcaggatcagcccgtagtgaacgccgtcattgat
ggcacggacatcgtgtatcgcgactacgttgacatctctgtggccgtggctacgccccgt
gggttggtggtgcccgtcatccgcaacgtggagggcatgaactatgccgacatcgagatc
gcactggccggtctggccgataaggccaggcgggatgccatcaccgtggaggacatggac
ggtggtaccttcaccatcagcaatggcggagtgttcggatccctgatgggcacgcccatc
atcaatccgccacagagtgccattctcggcatgcacggcatctttgatcggccaattgct
gtcaagggagaggtcaagatacgtcctatgatgtacatcgccctgacctacgatcaccga
atcattgatggacgtgaggcggtcctgttcctgcgaaaaataaaggctgctgtagagaac
ccagcaattattgttgccggattgtaa

DBGET integrated database retrieval system