KEGG   Drosophila simulans: Dsimw501_GD18770Help
Entry
Dsimw501_GD18770  CDS       T01065                                 

Gene name
Dsim_GD18770
Definition
(RefSeq) GD18770 gene product from transcript GD18770-RB
  KO
K14316  
nuclear pore complex protein Nup121
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsimw501_GD18770 (Dsim_GD18770)
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dsimw501_GD18770 (Dsim_GD18770)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 1282 aa AA seqDB search
MERRRFNMSSMSPMADSTRIDASLISNRPAANFLRGLSPKSNKLNGTRTPERSLMNCSVS
SSSSMSRQKLNRSQVDPRTFADAHSSGLSSRIVALSERSGLQRSMSASNLYNPMTQPRRA
PASPLPYKSRGPTLSITQIAPPERSFYSGNTLSSLLRSNSLVGLVQKTSEQEQLSRENRP
ILHPPHPQHESEPTRSVLEELKEISRKRINTGDTQHAQDNTKRSCLRSFDFVDHHRHQQQ
IHHLQQQQNQSFKRQRELTVSVPLRHHSTSLSAAPPALQHMHSNGNISPTQSPEQVAKRR
NCSYSNDIASSLSSSFRHSNKRKLLDMRERFQHSKNDTLASGGSSPENSPENVAKIQRKV
DAEAVSKSVSMPVVAVSAVPPSRAISAPVIQKAVPQVTEKPKLTLFNARQSETQAEQPRH
DLSSPEVDAGEYAGIQFVKPKQQNSMLAAKNPSLERTHKTKLAIMLSGLKGELYQGEPDE
LDAPAPKSAASPATLPTPIKPIIIAPVTTSTTAVISTATVSTAPSKPVILSNQVIKPADV
PNTISTGSVPKLMLGQPAPPAKTEQTPPKPIDKVPAGQADIPAKFELSTKPVTPATSAQP
LISFGTPKSTAAPSFSFGSATNTSSSTTTNTTNTTTSKPIFSFGQTPVNGPTVGGLSVFK
TDTPATTSVSTTNPGTPVTSTTTFGVTPPKTTTTVAPTTTVSLSFGQPNSATLVATSKST
TTATMPSFEAANTAGKPMFSFGKSNNLSSGTPTTKGSDAAAAKPALFSFGGTTTQPAAAA
APPTPVFGSLSKPLAGGFASPGANKSETTKPGIFGNLDNGLGNAMKPPANVAATTAAELP
KPFGFAATTTAAGGGSPADTSSYLAFGGTATSKAAEPAPASQKNLFGQNATTTTPFAFGG
AAAATTGKSENKDNKPFAFGGGDNNAVAKPSGVFSFGGTDKSAPPAFGSGTTSVTSATAT
PTNNTFGFGTAQKPATPMFGSGSTQQSSTPAVAATKPFTFGGRAPQAPTTPSASPASGGF
SFSAVAAKNTTAPTAETNMFGSPASASKSSFNFGGNTATQAPAAGSPAGGFSFAAAIKKE
DPPSTNMFGSPNTGVVKPNFGFSSTNPTPAPTFGGFGAPAAAAPTATSTNQSKPFAFGAS
TPAAAPSAAPLGGNLFANAVSATQNQTKPPGVFSFGTAKSTAGTTAGNAPFSFGGASAGG
IASPPSNQGLNTAKPFSFGGAGGTPAPNVFGSPAPAPPASNPAGGFNFGGASPAQQANAG
NMFAPPTPEGRPIRKATRRLQK
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgtcgctttaacatgagcagcatgtcacccatggcggattccacgcggatc
gacgcgtcgctgataagcaatcgtccggcggccaatttcctgaggggactgagtcccaag
tcgaataagctcaatggcacacgcactccggagcggtccttgatgaattgctctgtctca
tcgtccagctccatgtcgcgacagaaactgaaccgcagtcaggtcgatcccagaacattt
gccgatgcgcacagcagcggactgtcatcccggatcgtggccttaagcgaacgcagtggt
ctgcagcgcagcatgtccgccagcaatctgtacaatcccatgacgcagccgcgcagagcg
cccgcttccccgttgccctacaagtcaagggggccgacgctttcgatcacgcagattgca
ccaccggagcgcagcttttattccggcaacacgctgtcaagcctgttgcgatccaactcc
ttggtagggttagtgcaaaaaaccagcgaacaggagcagctttcgagagagaatcgaccc
atattgcacccacctcatccacagcatgagagcgagccaactagaagcgtgctggaggag
cttaaggagatctcccgaaagcgcatcaacactggagatacgcaacatgctcaagacaac
acgaaaaggagttgcctgcgaagctttgactttgtggaccatcaccgtcatcaacagcaa
atacatcatttgcagcaacagcaaaatcagtcctttaaaaggcaacgagagctgacggta
tcggttccgcttaggcatcattcgacatctttgtcggctgctcctcctgcattgcagcat
atgcactcgaatggaaacatctccccaactcaatctccggagcaggtggccaaacggcgc
aattgtagctacagcaacgacatcgcttcctcgctgagttccagtttccgtcacagcaac
aagaggaagctgttggacatgcgagaaaggtttcagcacagcaaaaacgacacactagct
agtggtggaagctcgcctgagaactcgcccgaaaatgtggccaaaattcaacgtaaagtt
gatgcagaagctgttagcaaatcagtgagcatgcccgtcgttgctgtgtcggcagttcct
ccttcacgagccatttcggcacctgtgattcaaaaggcagttccgcaggtgacggaaaaa
cctaagcttacactcttcaatgcgcgacaatctgaaacgcaagcggaacagccgcggcac
gatttgagtagcccggaagtagatgccggcgaatatgcaggcattcagtttgtaaagcct
aagcagcagaattccatgctggccgcgaagaatcctagcttagaacgcactcacaagacc
aaactagccattatgctaagtggattgaagggcgaactgtaccaaggtgagccggacgaa
ctagatgccccagcgccaaagtcagcggcatcgcctgcaacgcttcctactcccatcaag
cccatcatcatagctcctgtaaccacatccacaacggccgttatttccaccgcaaccgta
tcaactgcgcccagcaagccggtaatactaagtaaccaggttataaagccggcagatgtg
ccaaatacgattagcactggctcagtgcccaaacttatgcttggtcagcctgcgccgccc
gctaaaacggaacaaacaccaccaaaacccatcgacaaggtcccggcaggacaagcagat
atcccagccaagtttgagctatcaaccaaacccgtcactccagcaacatcagctcaacca
ctaatcagttttggcacaccgaaatccacagccgcaccatcattctcatttggaagtgca
accaatacctctagtagcactactaccaatactaccaatactaccacatcaaaacccata
ttctcgttcggacaaacgcctgtcaatggtcccacagtaggcggcctttctgtattcaaa
actgacacaccggcaacaacttcggttagcacaactaatcctgggacaccggttacatct
acaactactttcggagtgacaccacccaaaacgacgactacagttgctccgactacaact
gtttcgctaagtttcggccagccgaattcagcaactttagtcgccaccagtaagagcacc
acaacagccacgatgccatcatttgaagcagcaaacacagcagggaaaccgatgttttcc
tttggtaaatcgaacaatttaagttcaggaactccgacaaccaaaggaagcgatgcagct
gccgccaagcccgctctattcagttttggaggtaccaccactcagccagctgcagctgca
gctccaccgacaccggtattcggaagtctatcaaaacccctagccggaggttttgcatcg
cccggggcaaacaaatctgagacaactaagcctggcatctttggcaatttggacaacgga
cttggaaacgcaatgaagcccccagctaatgtagcagccacaaccgccgccgagcttccc
aagccatttggcttcgcagctacaacaaccgctgctggcggaggatcaccagcagataca
tcgtcttatcttgcatttggagggacggccacttcaaaggcagcggaaccagctccagct
agccaaaaaaacctttttggacaaaatgcaaccacaactacgccctttgcattcggagga
gcagcagcagccaccacaggtaaaagtgaaaataaggacaacaaaccatttgcatttggc
ggaggtgacaacaacgcggtagccaagccaagtggagtattcagctttggtggcacggac
aagagtgcaccaccagcctttggcagcggaacaacatcggtaacatctgccacagcaaca
ccgacaaacaacacctttgggtttggcacggctcagaagcctgcaacacccatgttcgga
agtggatcaacgcaacagtcttcgacaccggcagtggcagccactaaaccttttacattt
ggtggtcgggctccacaagctcctactacaccgtcagcatctccagcttctggaggattc
tcgttttccgccgttgcggccaaaaatactacggcgccaacagcagaaacaaatatgttt
ggcagccccgccagcgccagcaagtcaagctttaacttcggaggaaacaccgccacccag
gcgccggcagcaggatcaccagctggtggcttttcattcgccgcggccattaagaaggaa
gatcctccaagcaccaatatgtttggaagccccaacaccggagtggtgaagcctaacttt
ggcttttcaagcaccaatccaactccagcccctacctttggcggattcggtgctccagca
gcggctgcaccaacagcaacttcaactaatcagagcaagccctttgcatttggggctagc
actccggctgctgcccccagcgcagcgcccttgggcggcaatctgtttgccaacgcagtg
tctgctacccaaaaccaaacgaagccgccaggagtcttctcatttggtacggctaagagc
accgccggcaccacagccggcaatgcccccttctcgtttggaggcgcatctgctggcggc
atcgcctcgccgcccagcaatcagggtttaaataccgcaaagccattcagctttggtggc
gctggcggcactccagccccgaatgtctttgggagcccagcccctgctccgccagcaagc
aatccagccgggggcttcaacttcggcggcgccagtccagcccagcaggcgaatgccggc
aacatgtttgccccccccacaccggagggtcgtccgatacgaaaggccactaggcggctg
cagaaataa

DBGET integrated database retrieval system