KEGG   Drosophila simulans: Dsim_GD18770Help
Entry
Dsim_GD18770      CDS       T01065                                 

Definition
GD18770 gene product from transcript GD18770-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsim_GD18770
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 907 aa AA seqDB search
MERRRFNMSSMSPMADSTRIDASLISNRPAANFLRGLSPKSNKLNGTRTPERSLMNCSVS
SSSSMSRQKLNRSQVDPRTFADAHSSGLSSRIVALSERSGLQRSMSASNLYNPMTQPRRA
PASPLPYKSRGPTLSITQIAPPERSFYSGNTLSSLLRSNSLVGLVQKTSEQEQLSRENRP
ILHPPHPQHESEPTRSVLEELKEISRKRINTGDTQHAQDNTKRSCLRSFDFVDHHRHQQQ
IHHLQQQQNQSFKRQRELTVSVPLRHHSTSLSAAPPALQHMHSNGNISPTQSPEQVAKRR
NCSYSNDIASSLSSSFRHSNKRKLLDMRERFQHSKNDTLASGGSSPENSPENVAKIQRKV
DAEAVSKSVSMPVVAVSAVPPSRAISAPVIQKAVPQVTEKPKLTLFNARQSETQAEQPRH
DLSSPEVDAGEYAGIQFVKPKQQNSMLAAKNPSLERTHKTKLAIMLSGLKGELYQGEPDE
LDAPAPKSAASPATLPTPIKPIIIAPVTTSTTAVISTATVSTAPSKPVILSNQVIKPADV
PNTISTGSVPKLMLGQPAPPAKTEQTPPKPIDKVPAGQADIPAKFELSTKPVTPATSAQP
LISFGTPKSTAAPSFSFGSATNTSSSTTTNTTNTTTSKPIFSFGQTPVNGPTVGGLSVFK
TDTPATTSVSTTNPGTPVTSTTTFGVTPPKTTTTVAPTTTVSLSFGQPNSATLVATTGKP
MFSFGKSNNLSSGTPTTKGSDAAAAKPALFSFGGTTTQPAAAAAPPTPVFGSLSKPLAGG
FASPGANKSETTKPGIFGNLDNGLGNAMKPPANVAATTAAELPKPFGFAATTTAAGGGST
ATNLFAFGGTATSKAAEPAPASQKNLFGQNATTTTPFAFGGAAAATTGKSENKDNKPFAF
GGVTTTR
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgtcgctttaacatgagcagcatgtcacccatggcggattccacgcggatc
gacgcgtcgctgataagcaatcgtccggcggccaatttcctgaggggactgagtcccaag
tcgaataagctcaatggcacacgcactccggagcggtccttgatgaattgctctgtctca
tcgtccagctccatgtcgcgacagaaactgaaccgcagtcaggtcgatcccagaacattt
gccgatgcgcacagcagcggactgtcatcccggatcgtggccttaagcgaacgcagtggt
ctgcagcgcagcatgtccgccagcaatctgtacaatcccatgacgcagccgcgcagagcg
cccgcttccccgttgccctacaagtcaagggggccgacgctttcgatcacgcagattgca
ccaccggagcgcagcttttattccggcaacacgctgtcaagcctgttgcgatccaactcc
ttggtagggttagtgcaaaaaaccagcgaacaggagcagctttcgagagagaatcgaccc
atattgcacccacctcatccacagcatgagagcgagccaactagaagcgtgctggaggag
cttaaggagatctcccgaaagcgcatcaacactggagatacgcaacatgctcaagacaac
acgaaaaggagttgcctgcgaagctttgactttgtggaccatcaccgtcatcaacagcaa
atacatcatttgcagcaacagcaaaatcagtcctttaaaaggcaacgagagctgacggta
tcggttccgcttaggcatcattcgacatctttgtcggctgctcctcctgcattgcagcat
atgcactcgaatggaaacatctccccaactcaatctccggagcaggtggccaaacggcgc
aattgtagctacagcaacgacatcgcttcctcgctgagttccagtttccgtcacagcaac
aagaggaagctgttggacatgcgagaaaggtttcagcacagcaaaaacgacacactagct
agtggtggaagctcgcctgagaactcgcccgaaaatgtggccaaaattcaacgtaaagtt
gatgcagaagctgttagcaaatcagtgagcatgcccgtcgttgctgtgtcggcagttcct
ccttcacgagccatttcggcacctgtgattcaaaaggcagttccgcaggtgacggaaaaa
cctaagcttacactcttcaatgcgcgacaatctgaaacgcaagcggaacagccgcggcac
gatttgagtagcccggaagtagatgccggcgaatatgcaggcattcagtttgtaaagcct
aagcagcagaattccatgctggccgcgaagaatcctagcttagaacgcactcacaagacc
aaactagccattatgctaagtggattgaagggcgaactgtaccaaggtgagccggacgaa
ctagatgccccagcgccaaagtcagcggcatcgcctgcaacgcttcctactcccatcaag
cccatcatcatagctcctgtaaccacatccacaacggccgttatttccaccgcaaccgta
tcaactgcgcccagcaagccggtaatactaagtaaccaggttataaagccggcagatgtg
ccaaatacgattagcactggctcagtgcccaaacttatgcttggtcagcctgcgccgccc
gctaaaacggaacaaacaccaccaaaacccatcgacaaggtcccggcaggacaagcagat
atcccagccaagtttgagctatcaaccaaacccgtcactccagcaacatcagctcaacca
ctaatcagttttggcacaccgaaatccacagccgcaccatcattctcatttggaagtgca
accaatacctctagtagcactactaccaatactaccaatactaccacatcaaaacccata
ttctcgttcggacaaacgcctgtcaatggtcccacagtaggcggcctttctgtattcaaa
actgacacaccggcaacaacttcggttagcacaactaatcctgggacaccggttacatct
acaactactttcggagtgacaccacccaaaacgacgactacagttgctccgactacaact
gtttcgctaagtttcggccagccgaattcagcaactttagtcgccaccacagggaaaccg
atgttttcctttggtaaatcgaacaatttaagttcaggaactccgacaaccaaaggaagc
gatgcagctgccgccaagcccgctctattcagttttggaggtaccaccactcagccagct
gcagctgcagctccaccgacaccggtattcggaagtctatcaaaacccctagccggaggt
tttgcatcgcccggggcaaacaaatctgagacaactaagcctggcatctttggcaatttg
gacaacggacttggaaacgcaatgaagcccccagctaatgtagcagccacaaccgccgcc
gagcttcccaagccatttggcttcgcagctacaacaaccgctgctggcggaggatcaact
gccacaaatctctttgcatttggagggacggccacttcaaaggcagcggaaccagctcca
gctagccaaaaaaacctttttggacaaaatgcaaccacaactacgccctttgcattcgga
ggagcagcagcagccaccacaggtaaaagtgaaaataaggacaacaaaccatttgcattt
ggcggagtgacaacaacgcggtag

DBGET integrated database retrieval system