KEGG   Drosophila simulans: Dsimw501_GD18792Help
Entry
Dsimw501_GD18792  CDS       T01065                                 

Gene name
Dsim_GD18792
Definition
(RefSeq) GD18792 gene product from transcript GD18792-RA
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dsimw501_GD18792 (Dsim_GD18792)
Protein kinases [BR:dsi01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   Dsimw501_GD18792 (Dsim_GD18792)
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsimw501_GD18792 (Dsim_GD18792)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dsimw501_GD18792 (Dsim_GD18792)
   Spindle formation proteins
    Dsimw501_GD18792 (Dsim_GD18792)
  Sister chromatid separation proteins
   Aurora kinases
    Dsimw501_GD18792 (Dsim_GD18792)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3R
AA seq 421 aa AA seqDB search
MSHPSDHVLRPKENAPLRMPEKSATVLNMQKNLLLGKKPNSENMAPASKPLPGSSGAVIR
SAATTVRPATKPGLGGSNPIASTEGSNFQKPMVPSVKKTTSEFAAPAPVAPTKKPESVSK
QKTAAASTEFSKELGAASSSADKEKTKTETQPQKPKKTWELNNFDIGRLLGRGKFGNVYL
AREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLI
LEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHK
GVLKIADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHA
PFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVMVHPWILAHT
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatccgtctgaccatgtgctgcgtcccaaggaaaatgctccgcttagaatgccg
gaaaaatcagcaaccgtgctcaatatgcagaagaacttgctattgggaaagaagcccaac
agcgagaatatggctccagccagcaaacccttgccaggatcctctggcgctgtgattagg
agtgcggcgaccaccgtgcgtccagctactaagccaggcctaggaggctccaatcctata
gcttccaccgaaggaagcaacttccagaaacccatggtgccgtccgtgaagaagaccaca
tcagagtttgctgctccggctccagtagcacccaccaagaagcccgaatcagtttccaag
cagaaaactgccgctgcgagcacggaattctccaaggaactgggtgcggccagcagctcc
gcggacaaagagaaaaccaagactgaaacccaaccccagaagccgaagaagacctgggag
ctcaacaactttgatattggtcgcctgctcggacgcggcaagtttggcaacgtttatttg
gcgcgcgaaaaggaatcccagttcgtggtggccctaaaagtgctctttaagcgccagatt
ggcgagtccaatgtggagcaccaagtgcggcgggagatcgagatacaatcgcacctgcgt
catccgcatatcctgcgtctgtacgcctactttcacgacgacgtgcgcatatacctgatc
ttggagtatgcgccacaaggaacgcttttcaacgccctgcaggcacagccgatgaagcgt
ttcgatgagcgccagtcggccacctatattcaggcgttgtgctcggcgctgctttatctg
catgagcgggacatcattcacagggacatcaagccggagaacttgctgctcgggcacaag
ggcgtcctaaagatcgccgacttcggttggtccgtgcacgaaccgaactccatgcgcatg
acactgtgcggcactgtcgattacttgccacccgaaatggttcagggcaagccgcacacg
aaaaacgtggatctatggagcctgggtgtgctctgctttgagctgctggtgggccacgct
cccttctactcgaagaactatgacgagacctacaagaagattctcaaggtggactacaaa
ctgccggagcacatttccaaggcagcatcacatctgatatccaagctgctggtccttaat
ccgcagcaccgcctaccgctggatcaggtgatggtgcatccttggatcctggcgcacacg
cagtga

DBGET integrated database retrieval system