KEGG   Drosophila simulans: Dsim_GD18795Help
Entry
Dsim_GD18795      CDS       T01065                                 

Definition
GD18795 gene product from transcript GD18795-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dsi  Drosophila simulans
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dsi00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dsi00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dsi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dsi00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dsi00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dsi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 636 aa AA seqDB search
MKLSVVLVALLPLLGAVSANRTFVVDYEKDQFLKDGEPFRFIAGSFHYFRAHPATWQRHL
RTMRAAGLNAVTTYVEWSLHNPRDGVYVWSGIADLEHFIRLAVGEDLLVILRPGPYICAE
RDMGGFPYWLLNKYPGIQLRTADVNYLSEIRIWYTQLFAKMSKYLYGNGGPIIMVQVENE
YGSFFACDLNYRNWLRDETESHVKGQAVLFTNDGPSVLRCGKIQGVLATMDFGATNDLKP
IWAKLRRYQPKGPLVNAEYYPGWLTHWTEPMANVSTQSITSTFINMLDHGASVNFYMFYG
GTNFGFTAGANDIGPGNYMADITSYDYDAPMTEAGDPTPKYQALRRIIGRYLPLPNQPVP
GPVPKRSYGTVRLTTCCSLLSQEARARLSTGFVQSAKPKSFEALGQYSGLVLYETWLPSF
QRDPSILSVPGLADRGYVYVDGEFVGILARETPVFDLPISASAGRRLQIIVENQGRINYG
RQLNDFKGILRDVRLDKQVLSNWNMTQFPLESYDNLEQLITQSDEAVRQGFQELKKLRTM
LRTGPAIYHGQLDIQKESDLADTYLDMSGWGKGIVFVNGENLGRYWPLVGPQVTLYVPAA
VLKVGSNRLVVVEYQQTPTSQELHFRDTPILNARTV
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaagtgtggtcctggtggctctactaccgctgctaggagctgtttcagcgaat
cgcactttcgtagtggactacgagaaggatcagtttctaaaggatggcgaaccatttcga
ttcattgccggttccttccactacttccgtgctcatccagccacctggcagaggcatctt
aggaccatgagagccgcgggtctgaatgcggtgactacctatgtggagtggtcattgcac
aatccgcgggatggcgtttatgtttggagcggcattgccgatctggagcactttatacgc
ctggccgtgggcgaggatctgctggtcatcctccgcccgggcccgtatatttgtgcggag
cgtgacatgggcggctttccctactggctgctaaataagtatccgggcattcagctccgg
acagcagatgtcaattatcttagcgaaattcgcatttggtatacccaactgtttgccaag
atgagcaaatatctgtatggcaatggtgggccaattatcatggttcaggtggagaacgaa
tatggctcgttctttgcctgcgatctcaactatcgcaattggctacgcgacgagaccgag
agtcatgtcaaaggtcaggcagtgctcttcaccaacgatggacccagtgtgctgcgctgt
ggaaaaatccagggcgtcctagcgaccatggactttggagccacgaacgatctcaagccc
atttgggccaaacttagaaggtatcagccgaagggtccgctggtcaatgcggaatactat
cccggctggctaacccactggacggagccgatggccaatgttagcacccaatcgattacc
tccacttttataaacatgctggatcatggtgccagtgtgaacttctacatgttctacggc
ggcaccaacttcggattcacagctggtgccaatgacattggacccggtaactacatggcg
gacatcaccagctacgattacgatgcacccatgacggaggcgggggatcccacacccaaa
taccaggctctgcgacgcatcattggccgctatctcccgctgccaaatcaacccgtgccc
ggacccgtgcccaagcgatcctacggaactgtgcgtctaaccacctgctgtagtcttctt
tcgcaggaggcgagagctcggctctccaccggatttgtgcagtccgccaagccgaagagc
ttcgaggctttgggacagtactctggcttggtgctctacgagacctggttgcccagtttc
cagcgtgatccgagcatccttagcgttcccggactagcggatcgaggttacgtttatgtg
gatggtgagtttgtgggtattctggccagggaaacacccgtgttcgacttgccaatcagt
gcaagtgccgggcggaggttgcagatcatcgtagagaatcagggacgcatcaactacggt
cgtcagctgaacgactttaagggcatcctgcgggatgtgcgactggacaagcaggtgttg
agcaactggaacatgacccaattccctctcgagtcgtatgacaatctggagcagctgatt
acccaatcggatgaggcagttcgtcagggcttccaggagctaaagaagttgcgcacaatg
ctgcgcactggtccggccatttaccacggtcaactggacatccagaaggagtctgatctg
gcggacacctatctggacatgtccggctggggcaagggcattgtctttgtgaatggcgaa
aatctcggcaggtactggcccctggtgggacctcaagtcaccctgtatgttccggccgct
gtgctcaaggtgggctcaaatcgactggtggtggtggagtaccagcagacacccacctca
caggagctgcacttccgggatacccccattctgaatgcgaggaccgtttag

DBGET integrated database retrieval system