KEGG   Drosophila simulans: Dsim_GD18795Help
Entry
Dsim_GD18795      CDS       T01065                                 

Definition
GD18795 gene product from transcript GD18795-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dsi  Drosophila simulans
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dsim_GD18795
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dsim_GD18795
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dsim_GD18795
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dsim_GD18795
   00511 Other glycan degradation
    Dsim_GD18795
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsim_GD18795
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dsim_GD18795
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsim_GD18795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 636 aa AA seqDB search
MKLSVVLVALLPLLGAVSANRTFVVDYEKDQFLKDGEPFRFIAGSFHYFRAHPATWQRHL
RTMRAAGLNAVTTYVEWSLHNPRDGVYVWSGIADLEHFIRLAVGEDLLVILRPGPYICAE
RDMGGFPYWLLNKYPGIQLRTADVNYLSEIRIWYTQLFAKMSKYLYGNGGPIIMVQVENE
YGSFFACDLNYRNWLRDETESHVKGQAVLFTNDGPSVLRCGKIQGVLATMDFGATNDLKP
IWAKLRRYQPKGPLVNAEYYPGWLTHWTEPMANVSTQSITSTFINMLDHGASVNFYMFYG
GTNFGFTAGANDIGPGNYMADITSYDYDAPMTEAGDPTPKYQALRRIIGRYLPLPNQPVP
GPVPKRSYGTVRLTTCCSLLSQEARARLSTGFVQSAKPKSFEALGQYSGLVLYETWLPSF
QRDPSILSVPGLADRGYVYVDGEFVGILARETPVFDLPISASAGRRLQIIVENQGRINYG
RQLNDFKGILRDVRLDKQVLSNWNMTQFPLESYDNLEQLITQSDEAVRQGFQELKKLRTM
LRTGPAIYHGQLDIQKESDLADTYLDMSGWGKGIVFVNGENLGRYWPLVGPQVTLYVPAA
VLKVGSNRLVVVEYQQTPTSQELHFRDTPILNARTV
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaagtgtggtcctggtggctctactaccgctgctaggagctgtttcagcgaat
cgcactttcgtagtggactacgagaaggatcagtttctaaaggatggcgaaccatttcga
ttcattgccggttccttccactacttccgtgctcatccagccacctggcagaggcatctt
aggaccatgagagccgcgggtctgaatgcggtgactacctatgtggagtggtcattgcac
aatccgcgggatggcgtttatgtttggagcggcattgccgatctggagcactttatacgc
ctggccgtgggcgaggatctgctggtcatcctccgcccgggcccgtatatttgtgcggag
cgtgacatgggcggctttccctactggctgctaaataagtatccgggcattcagctccgg
acagcagatgtcaattatcttagcgaaattcgcatttggtatacccaactgtttgccaag
atgagcaaatatctgtatggcaatggtgggccaattatcatggttcaggtggagaacgaa
tatggctcgttctttgcctgcgatctcaactatcgcaattggctacgcgacgagaccgag
agtcatgtcaaaggtcaggcagtgctcttcaccaacgatggacccagtgtgctgcgctgt
ggaaaaatccagggcgtcctagcgaccatggactttggagccacgaacgatctcaagccc
atttgggccaaacttagaaggtatcagccgaagggtccgctggtcaatgcggaatactat
cccggctggctaacccactggacggagccgatggccaatgttagcacccaatcgattacc
tccacttttataaacatgctggatcatggtgccagtgtgaacttctacatgttctacggc
ggcaccaacttcggattcacagctggtgccaatgacattggacccggtaactacatggcg
gacatcaccagctacgattacgatgcacccatgacggaggcgggggatcccacacccaaa
taccaggctctgcgacgcatcattggccgctatctcccgctgccaaatcaacccgtgccc
ggacccgtgcccaagcgatcctacggaactgtgcgtctaaccacctgctgtagtcttctt
tcgcaggaggcgagagctcggctctccaccggatttgtgcagtccgccaagccgaagagc
ttcgaggctttgggacagtactctggcttggtgctctacgagacctggttgcccagtttc
cagcgtgatccgagcatccttagcgttcccggactagcggatcgaggttacgtttatgtg
gatggtgagtttgtgggtattctggccagggaaacacccgtgttcgacttgccaatcagt
gcaagtgccgggcggaggttgcagatcatcgtagagaatcagggacgcatcaactacggt
cgtcagctgaacgactttaagggcatcctgcgggatgtgcgactggacaagcaggtgttg
agcaactggaacatgacccaattccctctcgagtcgtatgacaatctggagcagctgatt
acccaatcggatgaggcagttcgtcagggcttccaggagctaaagaagttgcgcacaatg
ctgcgcactggtccggccatttaccacggtcaactggacatccagaaggagtctgatctg
gcggacacctatctggacatgtccggctggggcaagggcattgtctttgtgaatggcgaa
aatctcggcaggtactggcccctggtgggacctcaagtcaccctgtatgttccggccgct
gtgctcaaggtgggctcaaatcgactggtggtggtggagtaccagcagacacccacctca
caggagctgcacttccgggatacccccattctgaatgcgaggaccgtttag

DBGET integrated database retrieval system