KEGG   Drosophila simulans: Dsimw501_GD18795Help
Entry
Dsimw501_GD18795  CDS       T01065                                 

Gene name
Dsim_GD18795
Definition
(RefSeq) GD18795 gene product from transcript GD18795-RA
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
dsi  Drosophila simulans
Pathway
dsi00052  Galactose metabolism
dsi00511  Other glycan degradation
dsi00531  Glycosaminoglycan degradation
dsi00600  Sphingolipid metabolism
dsi00604  Glycosphingolipid biosynthesis - ganglio series
dsi01100  Metabolic pathways
dsi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dsimw501_GD18795 (Dsim_GD18795)
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dsimw501_GD18795 (Dsim_GD18795)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dsimw501_GD18795 (Dsim_GD18795)
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dsimw501_GD18795 (Dsim_GD18795)
   00511 Other glycan degradation
    Dsimw501_GD18795 (Dsim_GD18795)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsimw501_GD18795 (Dsim_GD18795)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dsimw501_GD18795 (Dsim_GD18795)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsimw501_GD18795 (Dsim_GD18795)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-GeneID: 6728439
NCBI-ProteinID: XP_016035041
UniProt: B4QTI2
Position
3R
AA seq 636 aa AA seqDB search
MKLSVVLVALLPLLGAVSANRTFVVDYEKDQFLKDGEPFRFIAGSFHYFRAHPATWQRHL
RTMRAAGLNAVTTYVEWSLHNPRDGVYVWSGIADLEHFIRLAVGEDLLVILRPGPYICAE
RDMGGFPYWLLNKYPGIQLRTADVNYLSEIRIWYTQLFAKMSKYLYGNGGPIIMVQVENE
YGSFFACDLNYRNWLRDETESHVKGQAVLFTNDGPSVLRCGKIQGVLATMDFGATNDLKP
IWAKLRRYQPKGPLVNAEYYPGWLTHWTEPMANVSTQSITSTFINMLDHGASVNFYMFYG
GTNFGFTAGANDIGPGNYMADITSYDYDAPMTEAGDPTPKYQALRRIIGRYLPLPNQPVP
GPVPKRSYGTVRLTTCCSLLSQEARARLSTGFVQSAKPKSFEALGQYSGLVLYETWLPSF
QRDPSILSVPGLADRGYVYVDGEFVGILARETPVFDLPISASAGRRLQIIVENQGRINYG
RQLNDFKGILRDVRLDKQVLSNWNMTQFPLESYDNLEQLITQSDEAVRQGFQELKKLRTM
LRTGPAIYHGQLDIQKESDLADTYLDMSGWGKGIVFVNGENLGRYWPLVGPQVTLYVPAA
VLKVGSNRLVVVEYQQTPTSQELHFRDTPILNARTV
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaagtgtggtcctggtggctctactaccgctgctaggagctgtttcagcgaat
cgcactttcgtagtggactacgagaaggatcagtttctaaaggatggcgaaccatttcga
ttcattgccggttccttccactacttccgtgctcatccagccacctggcagaggcatctt
aggaccatgagagccgcgggtctgaatgcggtgactacctatgtggagtggtcattgcac
aatccgcgggatggcgtttatgtttggagcggcattgccgatctggagcactttatacgc
ctggccgtgggcgaggatctgctggtcatcctccgcccgggcccgtatatttgtgcggag
cgtgacatgggcggctttccctactggctgctaaataagtatccgggcattcagctccgg
acagcagatgtcaattatcttagcgaaattcgcatttggtatacccaactgtttgccaag
atgagcaaatatctgtatggcaatggtgggccaattatcatggttcaggtggagaacgaa
tatggctcgttctttgcctgcgatctcaactatcgcaattggctacgcgacgagaccgag
agtcatgtcaaaggtcaggcagtgctcttcaccaacgatggacccagtgtgctgcgctgt
ggaaaaatccagggcgtcctagcgaccatggactttggagccacgaacgatctcaagccc
atttgggccaaacttagaaggtatcagccgaagggtccgctggtcaatgcggaatactat
cccggctggctaacccactggacggagccgatggccaatgttagcacccaatcgattacc
tccacttttataaacatgctggatcatggtgccagtgtgaacttctacatgttctacggc
ggcaccaacttcggattcacagctggtgccaatgacattggacccggtaactacatggcg
gacatcaccagctacgattacgatgcacccatgacggaggcgggggatcccacacccaaa
taccaggctctgcgacgcatcattggccgctatctcccgctgccaaatcaacccgtgccc
ggacccgtgcccaagcgatcctacggaactgtgcgtctaaccacctgctgtagtcttctt
tcgcaggaggcgagagctcggctctccaccggatttgtgcagtccgccaagccgaagagc
ttcgaggctttgggacagtactctggcttggtgctctacgagacctggttgcccagtttc
cagcgtgatccgagcatccttagcgttcccggactagcggatcgaggttacgtttatgtg
gatggtgagtttgtgggtattctggccagggaaacacccgtgttcgacttgccaatcagt
gcaagtgccgggcggaggttgcagatcatcgtagagaatcagggacgcatcaactacggt
cgtcagctgaacgactttaagggcatcctgcgggatgtgcgactggacaagcaggtgttg
agcaactggaacatgacccaattccctctcgagtcgtatgacaatctggagcagctgatt
acccaatcggatgaggcagttcgtcagggcttccaggagctaaagaagttgcgcacaatg
ctgcgcactggtccggccatttaccacggtcaactggacatccagaaggagtctgatctg
gcggacacctatctggacatgtccggctggggcaagggcattgtctttgtgaatggcgaa
aatctcggcaggtactggcccctggtgggacctcaagtcaccctgtatgttccggccgct
gtgctcaaggtgggctcaaatcgactggtggtggtggagtaccagcagacacccacctca
caggagctgcacttccgggatacccccattctgaatgcgaggaccgtttag

DBGET integrated database retrieval system