KEGG   Drosophila simulans: Dsimw501_GD18893Help
Entry
Dsimw501_GD18893  CDS       T01065                                 

Gene name
Dsim_GD18893
Definition
(RefSeq) GD18893 gene product from transcript GD18893-RA
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dsi  Drosophila simulans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dsimw501_GD18893 (Dsim_GD18893)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dsimw501_GD18893 (Dsim_GD18893)
Lipid biosynthesis proteins [BR:dsi01004]
 Desaturase
  First
   Dsimw501_GD18893 (Dsim_GD18893)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3R
AA seq 408 aa AA seqDB search
MSPNIIGSTFILAETAIADGNNNKMAATPAASAAPPAATPSQKVAKKAEAKTPENKPYEL
EIVWRNVGLFVILHSMALYGLYLVFAESAYWELLPVYATMFLGGLGITAGVHRLWSHKAY
KAKLPLRIFLMLCQSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCK
KHPDVTSKGKQISMEDIEQDPVVMFQKKMYFVVMPICCFALPMIFPYYVMGSSLRVCFFT
CSMLRFCLSLHFTWLVNSAAHFYGMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDY
KAAELGTYSFNWTTAFIDVMAKIGQAYDLKFVSQEMVYKRVLRTGDGSHIAALLDANNNS
AIPTSELVAHLDHEKEEHAIWGWDDKDISEEDRKGANVVNKESECKLD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaacataataggcagtacctttatattggccgagacggccattgccgatggc
aacaacaacaaaatggccgccacaccagcagcttccgccgcccctcctgcagccacgccc
agccagaaggtggccaagaaggcggaggccaagacgcccgagaacaagccctacgaactg
gagatcgtgtggcgcaacgtgggactcttcgtcatcctccactcgatggccctgtacggt
ctgtacctggtgttcgccgagagtgcctactgggaactcttgccagtctatgccaccatg
ttcctcggaggtcttggcatcacggccggagtgcatcgtctgtggtcgcacaaggcctac
aaggctaagctgccattgcgcatcttccttatgctgtgccagtccctggccttccagaac
agcatctgggagtggacccgtgaccaccgtgtgcaccacaagttcaccgacacacacgcc
gatccccacaactcccgtcgcggcttcttcttcgcccacatgggctggctgatgtgcaag
aagcaccccgatgtgaccagcaagggcaagcagatctccatggaggacattgagcaggat
cccgtcgttatgttccagaagaaaatgtactttgtggtgatgcccatctgctgcttcgcc
ctgcccatgatcttcccctactacgtgatgggcagctcgctgcgcgtctgcttcttcacc
tgctccatgctgcgcttctgcctgtcgctgcacttcacctggctggtgaacagcgccgcc
cacttctacggcatgaagccctacgatgtcaacgtgagcgccatgaacaacaagctggtg
tccaccctgaccatcggcgagggatggcacaactaccaccacgtcttcccctgggactac
aaggcagcagagctgggcacctacagcttcaactggacgacggcctttatcgatgtgatg
gctaagatcggacaagcctatgacctgaagttcgtctcgcaggagatggtctacaaacga
gtccttcgcactggcgatggctcccacattgccgccctgctggatgccaacaacaacagt
gccattccgaccagcgagctggtggcccacctggatcacgagaaggaggagcacgccatt
tggggatgggacgacaaggatatcagcgaggaggatcgcaagggagccaatgtggtgaac
aaggagtccgagtgcaagctggattag

DBGET integrated database retrieval system