KEGG   Drosophila simulans: Dsim_GD19018Help
Entry
Dsim_GD19018      CDS       T01065                                 

Definition
GD19018 gene product from transcript GD19018-RA
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dsi  Drosophila simulans
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dsi01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dsi00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:dsi00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dsi00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 351 aa AA seqDB search
MALSVRQSSSSVLATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSLVIIKG
TGDKAFCAGGDVRALVEAGPTDESKSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGL
SVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGGDVFYS
GIATHYCESSKIPDLETALLNCPDADDVPELLQKYHSTPEKPFSLQPVLEQINKNFSADS
VEGILENLQNDGSEWAKKTLETLSKMSPTSMKVTFRQLELGSQLSLAQCLIMEYRLAVHH
LERSDFKEGVRALLIDKDQKPQWQPTKLADVTEEHVQWFFRKLPDTEELKL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccctctccgtccgccaatcctcctcctccgtgctggccacggagtcttctaataag
ggaatgattattctaaaccgccccaaggcgcttaatgccatcaacttggagatggtacgc
aagatctacaagcacctgaagaagtgcgagaagtccaagtcgctggtgatcatcaagggc
acaggtgacaaggccttctgcgccggtggagatgtgcgcgctctggtcgaggctggcccc
acggatgagtcgaagagctttttccgggaggagtacagcacgaatgccctgatcgggaac
tataagattccgtacatcgccatcatcgacggtattaccatgggcggtggcgtgggtctg
agtgtgcacggcaagtaccgggtggccagcgatcggacgctgttcgccatgcccgagacg
gcgattggcctcttcccggatgtgggtggatcatacttcctacctcgactgcagggaaag
ctgggcctctacctgggtctcacaggatatcgactgcgcggcggcgatgtcttttactcg
ggcattgccacgcactactgcgagagcagcaagatccccgatctcgagacggctctcctt
aactgcccggatgcggatgatgtgcctgagctgctgcagaagtaccattccacgccagaa
aagcccttctcgctgcagcctgtcctggaacagatcaacaagaacttttcggcggactcg
gtggagggaattctagagaatctgcagaacgatggcagtgaatgggccaagaagacgctt
gagacgctctcgaagatgtctcccacctcgatgaaggttacgttccgtcagttagagctc
ggatcacagctgtcgctggctcagtgtcttattatggaatatcgtctggccgtgcatcat
ctggagcgcagtgatttcaaggagggagtgcgtgcccttctcatcgacaaggatcagaag
ccccagtggcagccaaccaagctggccgatgtcaccgaggagcatgtgcagtggttcttc
cgcaagctgccggacaccgaagaactcaagctgtaa

DBGET integrated database retrieval system