KEGG   Drosophila simulans: Dsimw501_GD19106Help
Entry
Dsimw501_GD19106  CDS       T01065                                 

Gene name
Dsim_GD19106
Definition
(RefSeq) GD19106 gene product from transcript GD19106-RA (EC:1.5.1.3)
  KO
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dsi  Drosophila simulans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsimw501_GD19106 (Dsim_GD19106)
   00670 One carbon pool by folate
    Dsimw501_GD19106 (Dsim_GD19106)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dsimw501_GD19106 (Dsim_GD19106)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3R
AA seq 182 aa AA seqDB search
MLRFNLIVAVCENFGIGIKGDLPWRIKSELKYFSRTTKRTSDPTKHNAVVMGRKTYFGVP
ESKRPLPDRLNIVLSTTLQESDLPKGVLLCPNLETAMKILEEQNEVENIWIVGGSGVYEE
AMASPRCHRLYITKIMQKFDCDTFFPAIPDSFREVAPDSDMPLGVQEENGIKFEYKVLEK
QS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcttcaatttaattgtggcagtttgcgagaatttcggaatcggcatcaaaggc
gatctaccatggcgcattaaatctgaactgaagtacttcagccgcaccaccaagcgaaca
agtgatcccaccaagcacaatgccgttgtgatgggcaggaaaacctacttcggagtgcca
gaaagcaagaggcctcttcccgataggctgaacatagtgctgagcaccacacttcaggag
agtgatctgcccaagggagtactcttgtgccccaatctcgagacggccatgaagatcctc
gaggagcagaacgaagtggagaacatttggattgtgggcggtagtggagtctacgaggag
gccatggcctcgccaagatgtcaccgactgtacattaccaaaataatgcagaagttcgac
tgcgacacatttttccccgcgatccctgacagctttcgagaggtagcgcccgattccgac
atgccactgggtgtgcaggaggagaatggcatcaaattcgagtacaaggttttggagaaa
cagtcataa

DBGET integrated database retrieval system