KEGG   Drosophila simulans: Dsim_GD19180Help
Entry
Dsim_GD19180      CDS       T01065                                 

Definition
GD19180 gene product from transcript GD19180-RA
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 561 aa AA seqDB search
MTTPVPRRTKDMMALGLDSDSEDDFNTPYRPRQAAAGERKQQPVASFQVQTRGKENEPHP
LPTNMLPRRVSELTMMDSDSDEEDIKSNHNLNCAILNDSFVLSPSQELTNSNSNITTRKT
SSAVPLKQSDSNLSFLGRFNDMGINCSSQGSPVANSEKQVVKKTAPTLQAAPSVTERRPL
QETETPLRNELASTSKTKPDADFITPQVRTIGSTLAGKSRSAVSNDFRAQKVLFQTPMTV
SRAAPVASDSISFSLCDTITESPDIPEPPKKAEPPKNQHPSKKSLDNVFRETDKDNAPAK
VDIVEPKEQVLIPAVAVPPEPSHPSHKTSNILKIKNHEYTIDKKLGCGGSSSVYLARRSD
SGNEFALKVVDLQADPQVVQGYLNETKLLAKLQGNVCVVALYDYQLVREESKLYMVMEKG
DCDLNKILQSYTTNLPLYSLMNILYQMLQAVNYIHQHGVIHSDLKPANFLMVSGRLKLID
FGIASNIAVDSTSIIKFSQAGTFNYISPEALTDTSTGNSPMRKADQPKINISTKSDVWSL
GCIFTATLPKDAVWPHPKRLC
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcctgtgccccgccgcaccaaggacatgatggcactgggactggactccgac
tcggaggacgactttaacacgccataccgaccacgacaagcggcggcgggagaacgaaaa
cagcagccagtggcgtctttccaagtccaaacgagaggcaaggagaacgaaccgcatccc
ctgcccacaaatatgctacctcgtcgagtgtccgagttgactatgatggattcggacagc
gacgaggaggacatcaagagcaatcacaaccttaactgcgccatcctaaacgattccttt
gtgctgagcccatcccaagagttaacaaacagcaacagcaacattaccactcgtaaaaca
tcaagtgccgtccccctcaaacaatccgattcgaatctctcgttcctgggaagattcaac
gacatgggcatcaactgcagcagtcaaggatcacctgttgcgaactcggaaaaacaagtg
gtcaaaaagacagcgcccacgcttcaagctgcaccaagtgtcaccgaaaggcgcccactc
caagagacagagacgccactgcgtaatgaattagcctccacctcgaagacgaagccggat
gcagacttcatcaccccacaagtgcgaacaattggttccacactagctggaaaaagtcgg
agtgcggtgtccaatgacttccgtgcgcagaaagtactcttccaaacacccatgaccgtg
agtcgtgctgctccagtggcctccgatagcataagcttctccctgtgcgacaccatcaca
gaaagcccggacattccagagcctccgaaaaaggcagaaccaccaaagaatcagcaccct
tccaagaagtccctagataatgttttccgggagacggacaaggataacgcgccagccaag
gtggatattgtggaaccaaaggagcaggtgctgattcccgcagttgctgtacctccagag
ccttcccacccatctcacaagacatctaatattttaaaaatcaagaatcatgagtatacg
attgacaagaaactgggctgtggcggctccagctctgtttatttggcacgccgatcggat
tccggaaatgagttcgccctgaaggtggtggatctgcaggccgatccacaagtggtgcag
ggatatctaaacgaaaccaaacttctggcaaagctacaagggaacgtttgcgttgtggca
ctttacgattatcaacttgtgcgcgaggagtccaagctgtacatggtgatggagaaaggc
gactgcgacttgaacaagatcctgcagagctacaccaccaaccttcctctctatagcctg
atgaacatcctgtaccaaatgctgcaagcggtcaactacattcaccaacacggtgtcatc
cattcggatctcaagccggcaaatttcctgatggtcagcggcagactgaagttgatcgat
tttggcatagccagcaatatcgctgtggactcgacgagcatcatcaaattctcgcaggcg
ggcacctttaactacattagtccggaggcattgacggacacctccacggggaatagtccg
atgcgcaaagccgatcagcccaagatcaatatctcgaccaaatcggacgtgtggtcgctg
gggtgcatctttactgctactctaccaaaagacgccgtttggccacatccgaaacgtcta
tgctaa

DBGET integrated database retrieval system