KEGG   Drosophila simulans: Dsim_GD19213Help
Entry
Dsim_GD19213      CDS       T01065                                 

Definition
GD19213 gene product from transcript GD19213-RA
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dsi  Drosophila simulans
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dsim_GD19213
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dsim_GD19213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 710 aa AA seqDB search
MHSNLWIFIWRRKLSFLLVVSGLVLLGLWTWAILIDTTAAAQPPAAQLSSSERQQQQQQQ
QSTGYQQVHIIQKLIEQANRVLRAERLKDNAVEKSPSPVQRLGNVRFLRPTQAKKAPLPI
SESFLFEQERLKILEQQQRQRNAGMEELNANAEDERMLSSAERQTQYEHELQRMGVPVVA
GIGPDGPRAPAERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQP
LAAHNAYKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQMRELAESPQSICP
SQPQSMALLEQMLTQVIELHSQCLGQATPATNVPVAQIRFTHIHIGCDEVQRMGECTSCR
QRLRSELFLSHVISMAHFIRRQWPHLGVVIWDDQLRSMSLSELQHSQVGSYVEPMVWVYA
SDIYRFIQPQLWDTYAKVFPSAWTASAFKGAFGESLLVPPLQHHLENNIRWLAVIAKEGG
RFSKGLRGLALTGWQRYDHFAVLCELLPVGIPSLMTSLSTVSKGYFSTNPRDNELLRVLQ
CVFQPDSRRSGRPWLELHPNAHHSQLFAVCNYPGHLVFKYALRLFDKLAEIRLYLQQTRD
QSAWLSDYNVRHNFSSPLRVRELTDRTPMLIEELRAMAREAQQLLWEVYDEYTVTEFVEQ
HIYPTIEALQRQLARAEMLLQRRTWPQRPLPLPLKVQEDMGLVTHQQEQQ
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgcactcaaatctttggatatttatttggcgccggaaactttccttcctgctcgtcgtg
tctggcctggtgcttctcggcctctggacatgggccatactaatcgatacgacagccgca
gcacagcctcctgccgcccaactctccagttctgagcgccagcagcagcagcagcagcag
cagtccacgggttaccagcaggtgcacatcatccagaagctgatcgagcaggccaaccgg
gtgctgcgagccgagcggctcaaggataacgccgtcgagaagtcgccatcgccagtccag
cggctgggaaacgtgcgattcctgcgacctacacaggccaagaaggcgccgctgcccatt
tccgagagcttcctgttcgagcaggagcgcctcaagattctggagcagcagcagcgccag
agaaacgccggcatggaggaactgaacgccaatgccgaggacgagcgaatgctcagttcg
gcggagcgacagactcagtacgagcatgagctccagaggatgggcgtgccggtggtggct
ggcatcgggccggatggtccgagagctcccgccgagcgtctcgttcacctggacctgaag
ggtgctccgcctaagctaagctttctcaagcaactgctgcccgtgctacgggcattggga
gccactggtctgctcatagagtacgaggacatgtttccctacagcggagttcttcagccg
ctggcggcgcacaatgcctacaaggaggacgaactgcgggacttcctcgagtgcgctgcc
ctccacgggctgagcgtaatgcccctcgttcaaacctttgggcacatggaatacgtcctc
aaactctcgggcttcgagcagatgcgtgagctggcggagagtccacagtcgatttgcccc
agtcagccacagagcatggcgctgctggagcagatgctcacccaagtgatcgaattgcat
tcacagtgcttgggtcaggcgacgcccgccaccaacgttcccgtagcacaaatacggttc
acccatatccacatcggctgtgacgaggtgcagcgcatgggcgagtgcaccagctgccgc
caaaggttgcgcagtgagctcttcctctcgcacgtgataagcatggcgcacttcatccgc
cgacagtggccgcatctgggtgtggttatctgggacgaccagttgcgatcgatgtccctc
agcgagctgcagcactcgcaagtgggcagctacgtggagccgatggtgtgggtgtacgcc
agtgacatataccgcttcattcagccacagctgtgggatacctatgccaaggtctttccc
agcgcctggacggcgtcggctttcaagggagcctttggtgagagcttgttggtgccgccg
ctgcagcatcatcttgagaacaacatccgatggctggcagtgatcgccaaggaaggcgga
cgcttctcaaagggattaagaggtctggcactgaccggatggcagcggtacgatcatttc
gcagtactctgtgaactcctgccggtaggcattcccagtctgatgacgtcgctgtcgacc
gtctccaagggctacttcagcactaatccgcgggacaatgagctgctgcgcgtgctgcag
tgcgtcttccagccggacagtcggcgatcgggtcgaccctggctggaactgcatccgaat
gcccatcatagtcagctctttgctgtgtgcaactatccgggtcacctggtcttcaaatat
gccctgcgcctgtttgacaagctggccgagatccgactctatttgcagcagacccgggac
cagagcgcctggctctccgactacaatgtgcggcacaacttcagttcgccgctgagggtg
cgcgaactgactgacaggacgccgatgctgatcgaggagctgcgggcgatggcgcgggag
gcgcagcagctgctgtgggaggtatacgacgagtacacggtgacggagtttgtggagcag
cacatttatcccaccatcgaggcactgcagcgccagttggccagggcggaaatgctgctc
cagcgacgcacttggccacagagaccactgcctctgcccttgaaagtgcaggaggacatg
ggactggtgacgcatcagcaggagcaacaatga

DBGET integrated database retrieval system