KEGG   Drosophila simulans: Dsimw501_GD19608Help
Entry
Dsimw501_GD19608  CDS       T01065                                 

Gene name
Dsim_GD19608
Definition
(RefSeq) GD19608 gene product from transcript GD19608-RB
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dsimw501_GD19608 (Dsim_GD19608)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 226 aa AA seqDB search
MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTIS
APHMHAFALEYLRDQLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAEL
VRLSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLAN
GGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcgatccgtgggagccaataatgaagacctcatacgccaactgaaggatcac
ggcgtcattgcaagtgatgcggtagcccaggcgatgaaggaaaccgaccgcaagcactac
tctccgcgcaacccctacatggacgccccgcaacccattggaggaggtgtcaccatcagt
gctcctcacatgcatgccttcgccttggagtacctacgcgaccaattgaagcccggtgca
cgcatactggacgtaggctctggatctggctacctcacagcctgcttttatcgttacatc
aaggctaagggtgttgatgcggatacccggatcgtgggcatagagcaccaggcagagctg
gtgcggctgagcaaggccaacttaaacaccgacgaccgtagcatgctggactccggccag
ttgctaatcgtcgagggtgacggccgcaagggatatcccccgaacgccccgtataatgca
atccatgtaggagcagctgctcccgacacgcccaccgaactcatcaaccaactggccaac
ggcgggcgcctgatagttccagtcggtcccgacggcgggtctcagtacatgcaacagtac
gacaaggacgccaatgggaaggtggagatgacacgtctcatgggcgtaatgtacgtcccc
ctcacggatcttcgctcctga

DBGET integrated database retrieval system