KEGG   Drosophila simulans: Dsim_GD19608Help
Entry
Dsim_GD19608      CDS       T01065                                 

Definition
GD19608 gene product from transcript GD19608-RA
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dsim_GD19608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 227 aa AA seqDB search
MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTIS
APHMHAFALEYLRDQLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAEL
VRLSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLAN
GGRLIVPVGPDGGSQYMQQYDKDANGKVYQKHFGHAPPYTSKTPKHF
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcgatccgtgggagccaataatgaagacctcatacgccaactgaaggatcac
ggcgtcattgcaagtgatgcggtagcccaggcgatgaaggaaaccgaccgcaagcactac
tctccgcgcaacccctacatggacgccccgcaacccattggaggaggtgtcaccatcagt
gctcctcacatgcatgccttcgccttggagtacctacgcgaccaattgaagcccggtgca
cgcatactggacgtaggctctggatctggctacctcacagcctgcttttatcgttacatc
aaggctaagggtgttgatgcggatacccggatcgtgggcatagagcaccaggcagagctg
gtgcggctgagcaaggccaacttaaacaccgacgaccgtagcatgctggactccggccag
ttgctaatcgtcgagggtgacggccgcaagggatatcccccgaacgccccgtataatgca
atccatgtaggagcagctgctcccgacacgcccaccgaactcatcaaccaactggccaac
ggcgggcgcctgatagttccagtcggtcccgacggcgggtctcagtacatgcaacagtac
gacaaggacgccaatgggaaggtataccaaaagcattttggacacgcccctccttacacc
tccaaaacgcccaagcacttttga

DBGET integrated database retrieval system