KEGG   Drosophila simulans: Dsimw501_GD19615Help
Entry
Dsimw501_GD19615  CDS       T01065                                 

Gene name
Dsim_GD19615
Definition
(RefSeq) GD19615 gene product from transcript GD19615-RA (EC:3.5.1.-)
  KO
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
dsi  Drosophila simulans
Brite
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dsimw501_GD19615 (Dsim_GD19615)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Dsimw501_GD19615 (Dsim_GD19615)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3R
AA seq 438 aa AA seqDB search
MTDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDML
RFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGA
QKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGD
GVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQV
FKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKELNVPTLVVGG
GGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFAPDFTLHPEINSRQDNANSKQYL
ELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRNNREEASDPDVRMSAADEDKLVDAK
NEFYDGDQDQDKPDSAES
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccggagggtgtcgtacttctacaacgcggacgtgggcaacttccactatgga
gccgggcatccgatgaagccgcagcgcctggcggtcacgcacagcctggtgatgaactac
ggactgcacaaaaaaatgaagatctacaggccgtacaaggccagtgcgcaggacatgctc
cgcttccacagcgacgagtacatcgcctacttacagcaggtgactccacaaaacattcag
tgcaattccgtggcctatacgaagtatctggctcacttcagcgtaggcgaggactgtccc
gtgttcgatggcctcttcgacttctgtgcaatgtacactggtgcctcgctggagggagcc
cagaagctgaaccacaaccacagcgacatatgcataaactggtcgggcggactgcatcac
gccaagaagtttgaggcaagcggattctgctacgtgaatgacatcgtcatcggcattctg
gagctgctaaagtaccatcctcgggtgctctacatcgacatcgatgtgcaccacggcgac
ggggtgcaggaggcgttctaccttacggaccgagtgatgacggcttcgttccacaaatac
ggaaactacttctttcccggcacgggagacatgtacgagatcggcgccgaatcgggacga
tactacagcgttaatgtgccgctaaaggagggcattgatgaccagagctatttccaggtg
ttcaaacccatcatttcggccattatggacttctaccggcccacggctatcgttttgcag
tgtggtgcggattctctggctggagatcggctgggttgcttctctctgagcaccaaggga
catggtgagtgtgtcaaatttgtgaaggaactgaacgtacccacattggtggtcggaggc
ggaggctacaccttacggaacgtggcccgctgctggacgcacgagacctcgctgctggtg
gaccaagacattgaaaatgacctgcccgccaccgagtattacgacttcttcgcccccgac
tttacactccatccagagattaactcacgccaagataatgcgaactcaaagcagtatctg
gaactcatcgttaagcatgtgtacgaaaaccttaagatgtgccagcactcgcccagcgtc
caaatggtgcagaccccgcctgatgtggacttggaggagctgcgcaacaaccgggaggag
gcgagtgatcccgacgtgcgaatgtccgcggccgatgaggacaagctggtcgatgccaag
aacgagttctacgacggcgatcaggaccaagacaagcccgattcggcagaaagttag

DBGET integrated database retrieval system