KEGG   Drosophila simulans: Dsim_GD19615Help
Entry
Dsim_GD19615      CDS       T01065                                 

Definition
GD19615 gene product from transcript GD19615-RA
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
dsi  Drosophila simulans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 438 aa AA seqDB search
MTDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDML
RFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGA
QKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGD
GVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQV
FKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKELNVPTLVVGG
GGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFAPDFTLHPEINSRQDNANSKQYL
ELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRNNREEASDPDVRMSAADEDKLVDAK
NEFYDGDQDQDKPDSAES
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccggagggtgtcgtacttctacaacgcggacgtgggcaacttccactatgga
gccgggcatccgatgaagccgcagcgcctggcggtcacgcacagcctggtgatgaactac
ggactgcacaaaaaaatgaagatctacaggccgtacaaggccagtgcgcaggacatgctc
cgcttccacagcgacgagtacatcgcctacttacagcaggtgactccacaaaacattcag
tgcaattccgtggcctatacgaagtatctggctcacttcagcgtaggcgaggactgtccc
gtgttcgatggcctcttcgacttctgtgcaatgtacactggtgcctcgctggagggagcc
cagaagctgaaccacaaccacagcgacatatgcataaactggtcgggcggactgcatcac
gccaagaagtttgaggcaagcggattctgctacgtgaatgacatcgtcatcggcattctg
gagctgctaaagtaccatcctcgggtgctctacatcgacatcgatgtgcaccacggcgac
ggggtgcaggaggcgttctaccttacggaccgagtgatgacggcttcgttccacaaatac
ggaaactacttctttcccggcacgggagacatgtacgagatcggcgccgaatcgggacga
tactacagcgttaatgtgccgctaaaggagggcattgatgaccagagctatttccaggtg
ttcaaacccatcatttcggccattatggacttctaccggcccacggctatcgttttgcag
tgtggtgcggattctctggctggagatcggctgggttgcttctctctgagcaccaaggga
catggtgagtgtgtcaaatttgtgaaggaactgaacgtacccacattggtggtcggaggc
ggaggctacaccttacggaacgtggcccgctgctggacgcacgagacctcgctgctggtg
gaccaagacattgaaaatgacctgcccgccaccgagtattacgacttcttcgcccccgac
tttacactccatccagagattaactcacgccaagataatgcgaactcaaagcagtatctg
gaactcatcgttaagcatgtgtacgaaaaccttaagatgtgccagcactcgcccagcgtc
caaatggtgcagaccccgcctgatgtggacttggaggagctgcgcaacaaccgggaggag
gcgagtgatcccgacgtgcgaatgtccgcggccgatgaggacaagctggtcgatgccaag
aacgagttctacgacggcgatcaggaccaagacaagcccgattcggcagaaagttag

DBGET integrated database retrieval system