KEGG   Drosophila simulans: Dsimw501_GD19661Help
Entry
Dsimw501_GD19661  CDS       T01065                                 

Gene name
Dsim_GD19661
Definition
(RefSeq) GD19661 gene product from transcript GD19661-RK
  KO
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsimw501_GD19661 (Dsim_GD19661)
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dsimw501_GD19661 (Dsim_GD19661)
   mRNA cycle factors
    P-body specific factors
     Dsimw501_GD19661 (Dsim_GD19661)
Chromosome [BR:dsi03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   TACC proteins
    Dsimw501_GD19661 (Dsim_GD19661)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 1230 aa AA seqDB search
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQKAMAAALGHQT
AVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLTTDMDTQLKTNHSDSDVFVECLSLHSE
RYTGDRSELEAYSSALNDVLEQQLSMTSASTLEAAFNDPLAVSQHNNVSYEDMDVDDDLN
ETMEMLKDSLDAEDHHFMQTHILSVTQPKPENNSVHLPNQEQNGVELDQLAKHSKRNSNA
KEPPFVESVLSEESGTQLLEPELTLSALDSTKDLAKHHEEEQTDTEDVFQKEDHHPVSSA
QMKEAQNPEEAKMALNLKEASSELSTKLANNLECPNQEKQFSVAVESMERTCTAISLEQS
ASPAMEATEDRTVEELDHMDVDESMRVDDAPVLNSCRQEQMHALSPVSSKSFSKPCVEND
TDFQNNKMDQKTAGKESPLKMTEIELPVESVPSAPLSPPIPTLQAKMMELPLSPPIPTHR
PKTAEELEFLALRELPLPDDDPTAEKVVFKQLSHGRVPVVAVSPTPLSLDLKGNTNTARL
PEPTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDFGAGVIAKS
PIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITEDKSQKGTENIEPSSTFAVS
LGSVDNKQRRTFSLVQPTKEEEEAKSRRTFCMEKENTRRTFCMQQNASPAVEATEDTGAD
EVMDVDISMRADEVAVMKSPQQTWKERQAPISNSPPIPTHQHLKRPPIHEANSPVSPLGN
GTVVLEEQALSAKEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNAD
EETGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTKGSNSAPID
RSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLLSPTLEEHETSDGNQSFGL
ISSAKDTAKKWDFKPPVDRTKKHVKMSVDVIDNDCNKTFDNSNTNTEDKTHNYNDMDELE
KKIKNEVTRSEDIEKKLKEGELREEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKE
QQAQLHERQLQEVQADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERK
QMMDNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEEISRVSMT
EQLQQKSRENADLLKICEELIYGKGQGGSS
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgacggcgcagaaaatggcctgggaatggaatttggcggtcgcggcattctg
cgggagatcaacaaaaacgatggcggcattaagctgagtccgctggcggtgaagcccagt
cccaagccgacgagcatggatcaacagaaggcaatggcggcagcgctgggccatcagacg
gcggtacccggtggccgtaagctggacgacgacctcgttccaaagtttggaggtcttccc
gagttcgatgagactcaaataccggaactggctcctttaactaccgatatggacactcaa
ctgaaaaccaaccattcggattctgatgtttttgtcgagtgtttatcgcttcatagcgag
cgctataccggagatcgatcggagttagaggcctattcaagtgccctcaatgatgttttg
gagcagcagctgtccatgacctcagcttctacactggaagctgcattcaacgatcctttg
gcggttagccagcacaacaacgtcagctatgaagacatggatgtggatgatgacctaaac
gaaaccatggaaatgttaaaggactccttggatgcggaagaccatcattttatgcaaacg
catattctcagcgtaacccagccaaaaccagagaataattctgtgcaccttccaaatcag
gaacaaaatggggttgaactagaccagttagccaaacactctaaacgcaatagtaatgca
aaggagccaccattcgtagaatcagtattgtctgaggagtctggtacacaacttcttgag
ccggagctcactttatctgccttggactctacgaaagacttagctaagcatcatgaggaa
gagcaaacggatacagaagatgtatttcagaaagaggaccaccatcccgtcagtagtgcg
cagatgaaggaggcacaaaatcctgaggaagctaaaatggccttaaatctcaaagaggct
tcttcagaactgtccacaaaactagcaaataatctagaatgccctaatcaagagaagcaa
ttttcggtggcagtagaatcaatggagagaacatgtactgccatcagccttgagcaaagt
gcatccccagctatggaggcaactgaagacaggactgtggaggagcttgatcacatggac
gtggatgaatccatgagagtggatgatgccccagtgcttaactcatgtcggcaggagcaa
atgcatgctctttctcccgtttcaagcaaatctttttcaaaaccctgcgttgaaaatgat
acggattttcaaaataataaaatggatcaaaaaactgcaggcaaagagagtccattgaag
atgactgaaatagagctgcctgtggaatctgtcccttcagcaccactctcaccgccgata
cccacacttcaagcaaaaatgatggaactgcccctttctccgcccatacctacacatcgc
ccaaaaacagcggaggaactagagttcctggctctgagggagctgcccttgcccgatgat
gaccccacggcggaaaaggtggtatttaagcagctatcacacggccgcgtacccgtggtg
gcagtctcaccaacgccactttccttggatctgaaaggaaatacaaacactgcaagactt
ccagaacccacttcgcccagtttccccatcaaagaacctgctgaaaaacagtcccacttt
ccacgctcaccccgtgctcagcccgagcaaaaggacatgccctatttggaagaggctgtt
gtagaacgttcttcagatcgcaagcaaagcgatttcggtgccggagtcatagcgaaatca
ccaatagtctttcagttaacacaaccgagtcctgagaagcagcacctcaacgaaaccttg
cccatgagcgaaatttctcccactccgtcaaatatgacctttgacagcggaagcattacg
gaggacaaatctcagaagggtacagagaatattgagccttcatccaccttcgccgtaagt
ctgggatcggtcgataataagcagcgccgcactttctcgttggttcagcccacgaaggaa
gaggaggaggccaaatcgcgtcggactttctgtatggaaaaggagaacactcgccgcacc
ttctgcatgcagcagaatgcctctccagcggtggaggccaccgaagataccggggctgat
gaagtcatggatgtagatatctccatgagggcagatgaagtagccgtgatgaagtcgccc
cagcaaacttggaaggaacgccaagcaccaatttcaaattcaccacctattcctacccat
caacatttaaaaagaccccctattcatgaggcgaattctccagtgtcaccattgggaaat
ggcaccgttgtgttggaggagcaggctctctctgctaaagagcaagccacgctgagcgcc
agcgatgagaaggacgatgttttcttggagcactttggtgccatttctccagtttcggat
gacatgttcaaaaccagcagcggctcgaacaatcaagcaaagtttagggtcaatgctgat
gaagaaaccggagtcaaaggcgcttctgcgatgatcaggaagagaagtggtacagctggc
gagcaggaagcgatcttcgatgccgaattccatgatggcgccaacaaccaaaacctgata
ctgaattcatcagattttgattatttgtacacgaaaggcagcaatagtgcgcctatcgac
cgcagttcgctgctgttgaagtttgatcccctccttggagcccctgttcccgttaatcat
ccgaatcagcaggagcaggcgctgcagaatattctgggatcgaaccagcaccagaaccgg
ctccttagcccaacattggaggagcacgaaacaagtgacgggaaccagtcttttggatta
atatcgagtgccaaagatacagccaagaaatgggattttaagccacctgtggatagaaca
aaaaagcatgttaaaatgagtgtagacgtcattgataacgattgcaacaaaaccttcgat
aattccaacactaatacggaggataagacgcacaactacaacgatatggatgagctggag
aagaaaatcaaaaatgaagtaacgcggtccgaagacattgaaaagaagctcaaagaggga
gagctgcgcgaggaggctctgatcaagcgtattacagaaaaggacaaaacaaatgcaaaa
ctaaacggtgtcatcgaggcgtatgagaaagcaattgcagagcttatcagtgagaaggag
cagcaggcacagcttcacgaacggcagttgcaggaagtccaggcagaccgggacgcaaat
taccatcacttaacgtcgttggagacgacattttccgatctgcatgtgaaatacgagaaa
agcaaagagatgacctcgcagctcaaaagcaacgaggaatcgcttctggcagagcgaaag
cagatgatggacaatctgcggttgcaggaacagcgctacgacaagatgaagaaccatgcc
atgcagcagctggaaattgccaacaaaaagctggacacctacgcgagggagcatgctgac
gagacgaaaaaacttaaagctttacttaagaaggaggagatctcgcgggtctcgatgact
gagcagctgcaacagaagtcacgcgaaaacgctgatctgctcaagatctgcgaggagctc
atctatggcaagggacaaggtggtagtagttaa

DBGET integrated database retrieval system