KEGG   Drosophila simulans: Dsim_GD19661Help
Entry
Dsim_GD19661      CDS       T01065                                 

Definition
GD19661 gene product from transcript GD19661-RA
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dsi  Drosophila simulans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsim_GD19661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1194 aa AA seqDB search
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQKAMAAALGHQT
AVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLTTDMDTQLKTNHSDSDVFVECLSLHSE
RYTGDRSELEAYSSALNDVLEQQLSMTSASTLEAAFNDPLAVSQHNNVSYEDMDVDDDLN
ETMEMLKDSLDAEDHHFMQTHILSVTQPKPENNSVHLPNQEQNGVELDQLAKHSKRNSNA
KEPPFVESVLSEESGTQLLEPELTLSALDSTKDLAKHHEEEQTDTEDVFQKEDHHPVSSA
QMKEAQNPEEAKMALNLKEASSELSTKLANNLECPNQEKQFSVAVESMERTCTAISLEQS
ASPAMEATEDRTVEELDHMDVDESMRVDDAPVLNSCRQEQMHALSPVSSKSFSKPCVEND
TDFQNNKMDQKTAGKESPLKMTEIELPVESVPSAPLSPPIPTLQAKMMELPLSPPIPTHR
PKTAEELEFLALRELPLPDDDPTAEKVVFKQLSHGRVPVVAVSPTPLSLDLKGNTNTARL
PEPTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDFGAGVIAKS
PIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITEDKSQKGTENIEPSSTFAVS
LGSVDNKQRRTFSLVEATEDTGADEVMDVDISMRADEVAVMKSPQQTWKERQAPISNSPP
IPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSAKEQATLSASDEKDDVFLEHFGAIS
PVSDDMFKTSSGSNNQAKFRVNADEETGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANN
QNLILNSSDFDYLYTKGSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQ
HQNRLLSPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKKHVKMSVDVIDNDCN
KTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELREEALIKRITEKDK
TNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEVQADRDANYHHLTSLETTFSDLHV
KYEKSKEMTSQLKSNEESLLAERKQMMDNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAR
EHADETKKLKALLKKEEISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgacggcgcagaaaatggcctgggaatggaatttggcggtcgcggcattctg
cgggagatcaacaaaaacgatggcggcattaagctgagtccgctggcggtgaagcccagt
cccaagccgacgagcatggatcaacagaaggcaatggcggcagcgctgggccatcagacg
gcggtacccggtggccgtaagctggacgacgacctcgttccaaagtttggaggtcttccc
gagttcgatgagactcaaataccggaactggctcctttaactaccgatatggacactcaa
ctgaaaaccaaccattcggattctgatgtttttgtcgagtgtttatcgcttcatagcgag
cgctataccggagatcgatcggagttagaggcctattcaagtgccctcaatgatgttttg
gagcagcagctgtccatgacctcagcttctacactggaagctgcattcaacgatcctttg
gcggttagccagcacaacaacgtcagctatgaagacatggatgtggatgatgacctaaac
gaaaccatggaaatgttaaaggactccttggatgcggaagaccatcattttatgcaaacg
catattctcagcgtaacccagccaaaaccagagaataattctgtgcaccttccaaatcag
gaacaaaatggggttgaactagaccagttagccaaacactctaaacgcaatagtaatgca
aaggagccaccattcgtagaatcagtattgtctgaggagtctggtacacaacttcttgag
ccggagctcactttatctgccttggactctacgaaagacttagctaagcatcatgaggaa
gagcaaacggatacagaagatgtatttcagaaagaggaccaccatcccgtcagtagtgcg
cagatgaaggaggcacaaaatcctgaggaagctaaaatggccttaaatctcaaagaggct
tcttcagaactgtccacaaaactagcaaataatctagaatgccctaatcaagagaagcaa
ttttcggtggcagtagaatcaatggagagaacatgtactgccatcagccttgagcaaagt
gcatccccagctatggaggcaactgaagacaggactgtggaggagcttgatcacatggac
gtggatgaatccatgagagtggatgatgccccagtgcttaactcatgtcggcaggagcaa
atgcatgctctttctcccgtttcaagcaaatctttttcaaaaccctgcgttgaaaatgat
acggattttcaaaataataaaatggatcaaaaaactgcaggcaaagagagtccattgaag
atgactgaaatagagctgcctgtggaatctgtcccttcagcaccactctcaccgccgata
cccacacttcaagcaaaaatgatggaactgcccctttctccgcccatacctacacatcgc
ccaaaaacagcggaggaactagagttcctggctctgagggagctgcccttgcccgatgat
gaccccacggcggaaaaggtggtatttaagcagctatcacacggccgcgtacccgtggtg
gcagtctcaccaacgccactttccttggatctgaaaggaaatacaaacactgcaagactt
ccagaacccacttcgcccagtttccccatcaaagaacctgctgaaaaacagtcccacttt
ccacgctcaccccgtgctcagcccgagcaaaaggacatgccctatttggaagaggctgtt
gtagaacgttcttcagatcgcaagcaaagcgatttcggtgccggagtcatagcgaaatca
ccaatagtctttcagttaacacaaccgagtcctgagaagcagcacctcaacgaaaccttg
cccatgagcgaaatttctcccactccgtcaaatatgacctttgacagcggaagcattacg
gaggacaaatctcagaagggtacagagaatattgagccttcatccaccttcgccgtaagt
ctgggatcggtcgataataagcagcgccgcactttctcgttggtggaggccaccgaagat
accggggctgatgaagtcatggatgtagatatctccatgagggcagatgaagtagccgtg
atgaagtcgccccagcaaacttggaaggaacgccaagcaccaatttcaaattcaccacct
attcctacccatcaacatttaaaaagaccccctattcatgaggcgaattctccagtgtca
ccattgggaaatggcaccgttgtgttggaggagcaggctctctctgctaaagagcaagcc
acgctgagcgccagcgatgagaaggacgatgttttcttggagcactttggtgccatttct
ccagtttcggatgacatgttcaaaaccagcagcggctcgaacaatcaagcaaagtttagg
gtcaatgctgatgaagaaaccggagtcaaaggcgcttctgcgatgatcaggaagagaagt
ggtacagctggcgagcaggaagcgatcttcgatgccgaattccatgatggcgccaacaac
caaaacctgatactgaattcatcagattttgattatttgtacacgaaaggcagcaatagt
gcgcctatcgaccgcagttcgctgctgttgaagtttgatcccctccttggagcccctgtt
cccgttaatcatccgaatcagcaggagcaggcgctgcagaatattctgggatcgaaccag
caccagaaccggctccttagcccaacattggaggagcacgaaacaagtgacgggaaccag
tcttttggattaatatcgagtgccaaagatacagccaagaaatgggattttaagccacct
gtggatagaacaaaaaagcatgttaaaatgagtgtagacgtcattgataacgattgcaac
aaaaccttcgataattccaacactaatacggaggataagacgcacaactacaacgatatg
gatgagctggagaagaaaatcaaaaatgaagtaacgcggtccgaagacattgaaaagaag
ctcaaagagggagagctgcgcgaggaggctctgatcaagcgtattacagaaaaggacaaa
acaaatgcaaaactaaacggtgtcatcgaggcgtatgagaaagcaattgcagagcttatc
agtgagaaggagcagcaggcacagcttcacgaacggcagttgcaggaagtccaggcagac
cgggacgcaaattaccatcacttaacgtcgttggagacgacattttccgatctgcatgtg
aaatacgagaaaagcaaagagatgacctcgcagctcaaaagcaacgaggaatcgcttctg
gcagagcgaaagcagatgatggacaatctgcggttgcaggaacagcgctacgataagatg
aagaaccatgccatgcagcagctggaaattgccaacaaaaagctggacacctacgcgagg
gagcatgctgacgagacgaaaaaacttaaagctttacttaagaaggaggagatctcgcgg
gtctcgatgactgagcagctgcaacagaagtcacgcgaaaacgctgatctgctcaagatc
tgcgaggagctcatctatggcaagggacaaggtggtagtagttaa

DBGET integrated database retrieval system