KEGG   Drosophila simulans: Dsim_GD20021Help
Entry
Dsim_GD20021      CDS       T01065                                 

Definition
GD20021 gene product from transcript GD20021-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dsi  Drosophila simulans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dsi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 521 aa AA seqDB search
MFRLLNALLIAIVLVAHPAWSAPECGRTPEECREHRMHPDMPEPERHSKAFRVVDGEETN
AYWRQQGVEFVQQKLASEPNKRQAKNVILFLGDGMGVTTTSAARNLLGGEEKSLSFENFP
FTGLSKTYSVDKIVPDSACTATAYLCGVKSGGNHWREWPGAPHDCKVMLDESTHVDSIAK
WAMDAGKWAGLVTTTRVTHASPSGVYAHIAERDWENDAEVATDCGAGSGINDIAYQLARG
EVGSKLKVIMGGGRKHFVDASLESWGKRTDGLNLIDEFKSASERNVYVTTAAELAAVDVT
KTDRLLGLFNDDHLQYLMETTEESSQPTLEQMTRKAIEHMSQNEQGYFLFIEGGRIDQAH
HINQARMALNETIEFSKAIAAAQELTSEDDTLLVVTADHSHVFTYAGYSYRGSDVFGKTP
VNGHDGKPYMVLSYANGPSYENFYDAETLERKDPTTVVKGAHDDEFPSGVPIDMDSHGGD
DVPVYALGPWAHLFTGVYEQSTIPHMMAYASCVGDGHTMCK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcctgctgaacgcactactgatcgccatcgtgctggtagcccatcccgcttgg
tccgctccggaatgcggtcgtactccggaggagtgcagggagcacaggatgcatccggat
atgccggaaccggaacgacatagcaaggcattccgggtggttgatggcgaggagaccaac
gcgtactggcgccaacagggagtggagtttgtccaacagaagttggcttctgagccgaat
aagcgccaggccaagaacgtgatcctcttcctcggcgatggaatgggtgtgaccaccacg
tcagcggctcgcaatctcttgggcggcgaggagaagtccctgtccttcgagaacttcccc
ttcacgggcctctcgaagacctattccgtggataagattgtgcccgactccgcttgcacg
gccactgcctatttgtgtggcgtgaaatcaggagggaaccattggcgtgaatggccaggt
gccccgcacgactgcaaggtcatgctggacgagagcacccacgtcgactccattgccaag
tgggccatggatgcgggcaagtgggcgggtctggtgaccaccacccgcgtcactcacgcc
tcgccctctggagtgtacgcccacatcgccgagcgcgactgggagaacgatgcggaggtg
gctaccgactgtggagcaggctctggaatcaatgacattgcttatcaactggcccgcggc
gaggtgggcagcaagctgaaggtgatcatgggcggcggacgcaagcactttgtggacgcc
agtctggagtcctggggcaagcgtaccgatggacttaacctcatcgatgaatttaagtca
gcaagcgaaaggaatgtctatgtgaccaccgccgcagagttggccgccgtggatgtcacc
aaaacggatcgcctcctcggcctcttcaacgacgaccatctgcagtacctcatggagacc
acagaagagagcagccaacccactttggagcagatgacccgcaaggccatcgagcatatg
agccagaacgagcagggctacttcctcttcatcgagggcggtcgcatcgaccaggcccac
cacatcaaccaggcgcgaatggctctgaacgaaactatcgagttctccaaggccattgcc
gctgcccaggagctgaccagcgaggatgacaccttgttggtggtcaccgccgatcattct
catgtgttcacctacgcaggatactcgtaccgtggatcggatgtatttggaaagactccc
gtaaatggacacgatggcaagccatacatggtgctgagctacgccaacggaccgagttac
gagaacttctacgacgcggagacgttggagcgcaaggatcccaccacggtggtgaaggga
gcccacgacgatgagtttccctcgggtgtgcccatcgacatggactcccacggaggcgac
gatgtgccagtctacgcgttgggtccctgggcgcacctgttcaccggagtctacgagcag
agcaccattccgcacatgatggcctacgcatcctgcgtgggcgacggtcataccatgtgc
aagtag

DBGET integrated database retrieval system