KEGG   Drosophila simulans: Dsimw501_GD20048Help
Entry
Dsimw501_GD20048  CDS       T01065                                 

Gene name
Dsim_GD20048
Definition
(RefSeq) GD20048 gene product from transcript GD20048-RB (EC:2.7.1.-)
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dsi  Drosophila simulans
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Longevity regulating pathway - multiple species
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dsimw501_GD20048 (Dsim_GD20048)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsimw501_GD20048 (Dsim_GD20048)
   04070 Phosphatidylinositol signaling system
    Dsimw501_GD20048 (Dsim_GD20048)
   04150 mTOR signaling pathway
    Dsimw501_GD20048 (Dsim_GD20048)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dsimw501_GD20048 (Dsim_GD20048)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dsimw501_GD20048 (Dsim_GD20048)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dsimw501_GD20048 (Dsim_GD20048)
Membrane trafficking [BR:dsi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    Dsimw501_GD20048 (Dsim_GD20048)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3R
AA seq 1088 aa AA seqDB search
MNMMDNRALAYVAHQPKYETPPEEAEPPCMRFSVNLWKNEMLNWVDLICLLPNGFLIELR
VNPANTIQVIKVEMVNQAKQMPLGYVIKEACEYQVYGISTFNIEPYTDETKRLSEVQPYF
GILSLGERTDTTSFSSDYELTKMVNGMIGTTFDHNRTHGSPEIDDFRLYMTQTCDNIELE
RSVYTWQQRLLYEHPLRLANSTKMPELIRERHPTRTFLIVVKNENDQSTFTLSVNEQDTP
FSLTESTLQKMNRSQMKMNDRTSDYILKVSGRDEYLLGDYPLIQFLYIQEMLSDSAVPNV
VLQSVYRLESYINHHNEQAMVTKRLPPKKQTVHPQKAISSLWDMGNYFQLTLHSISNVNF
DKTRALKVGVHVCLYHGDKKLCAQRSTDSPNGNFDTFLFNDLVMDFDIQMRNLPRMTRLC
IVIFEVTKMSRSKKSSNNKDIALKDVPYNKNPLAWVNTTIFDHKDILRTGRHTLYTWTYA
DDIQSVEVFHPLGTIEPNPRKEECALVDLTFHSSGTGTVRYPSEDVVLQYAAEREQANRL
QRQLAGPEKPIKELKDLVANYTGLDKIYEMVDQDRNAIWERRNDILREIPEELSILLHCV
YWKERDDVADMWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLHFLKDEDLLLYLL
QLVQAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPSMQTRFGLLLEVYLK
GCKHHVAPLRKQLHVLEKLKQGSLIAKKGSKEKVKTMLQDFLRDQRNSGVFQNIQNPLNP
SFRCSGVTPDRCKVMDSKMRPLWVVFENADVNASDVHIIFKNGDDLRQDMLTLQMLRVMD
QLWKRDGMDFRMNIYNCISMEKSLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSW
LKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILG
HFKEKLGVRRERVPFVLTHDFVYVINKGFNDRESKEFCHFQELCERAFLVLRKHGCLILS
LFSMMISTGLPELSSEKDLDYLRETLVLDYTEEKAREHFRAKFSEALANSWKTSLNWASH
NFSKNNKQ
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgatggacaacagggcgttggcctacgtggcccaccagcccaagtatgagaca
ccaccggaagaggcggagccgccatgcatgcgcttttcggttaacctgtggaagaacgag
atgctgaactgggtagacctgatctgcctgttgcccaatggattcctgatagagctcagg
gtcaatccggcgaacaccatccaggtcatcaaggtggagatggtcaaccaggccaaacag
atgccactgggctatgtgatcaaagaggcctgcgagtaccaggtgtacggcatctcgacc
ttcaacatcgaaccgtacaccgacgaaacgaagcgactcagtgaggtgcagccgtacttc
ggaatcctcagcctgggcgagcgcaccgacacaacgagctttagcagcgactacgagctg
accaagatggtcaacggaatgatcggcaccaccttcgaccataatcgaacgcacggctcg
cccgagattgacgacttccggctgtacatgacccaaacttgcgacaacatcgaactggag
cgctccgtctacacctggcagcagagactactctacgagcatccgctgcggctggcgaac
tcgactaagatgcccgagctgatacgggagcggcatccgaccagaacctttctcatcgtc
gtgaaaaacgagaacgaccagagtacgtttacgttgtcggtgaacgagcaggacactccc
ttctcgctcacggaaagcacgctgcagaagatgaatcggtcgcagatgaaaatgaacgac
cggacctccgactacatactcaaggtgagcggtcgcgacgagtacctgcttggggactat
ccgctgatccagttcctgtacatccaagagatgctctcggactcggcggttccgaatgtg
gtactgcaatcagtgtaccgccttgagtcctatatcaaccaccacaacgagcaggccatg
gtaaccaagcgtttgccgccgaaaaaacagacagtccacccccaaaaggcaatctcttcg
ctgtgggacatgggcaactactttcagctgacgctacacagcatctccaatgtaaacttt
gacaagacgcgcgccctcaaggtgggcgtgcatgtgtgcctatatcacggcgacaagaag
ttatgcgcccagcgatcaacggactcccctaatggcaactttgacacgttcctgtttaat
gacctggtgatggactttgacatacagatgcgcaacctaccgcggatgacacgactctgc
attgtgatcttcgaggtgaccaaaatgtcgcgctcgaagaagtcgtccaacaataaggac
atcgctctgaaagacgtcccctacaacaaaaacccgctggcttgggtcaacacaacaatt
ttcgaccacaaggatatcctgcgcaccggtcgacatacgctgtacacgtggacgtatgct
gacgacattcagtcggttgaggttttccatccgctgggcaccatcgagcccaatccgcgc
aaagaggaatgtgcgctggtggacctcacattccacagcagcggaaccggaaccgtgcgg
tatcccagcgaggatgtcgtattgcagtacgctgcggagcgggagcaggccaatcgactg
caacggcaactggcagggccagaaaagccgatcaaagaactgaaggatctggtggccaat
tatacgggactggataagatctacgaaatggttgaccaggaccgcaatgccatttgggaa
cggagaaacgacattttgcgcgagattccggaagagctgtccatcttactacactgcgtc
tattggaaggagcgtgatgacgtagcggatatgtggtatcttctcaaacagtggccgctt
atttctatagaacgctccttggagctactggactacgcatatccagatccggcagtaaga
cgctttgccatccggtgcttacactttctgaaagacgaagacttgctcctgtatctgctg
caattggtacaggccatcaagcacgaatcgtacctggaaagcgatctggtagtgtttctg
ctggagcgagcactgcgcaaccagcgcatcggccactacttcttctggcacctacgctct
gagatgcagacgccgtctatgcaaacacgctttggcctactgctggaagtatacctcaag
ggttgcaaacatcacgtggcgccgctgcggaagcagcttcatgtgctagagaagctgaaa
cagggatctctgattgccaagaagggtagcaaggaaaaggtgaagaccatgctgcaggac
tttctgcgggaccagcgcaactcgggggtctttcagaacatccaaaatccacttaatccc
agcttccggtgcagcggtgtaacccccgataggtgcaaggtaatggatagcaagatgcga
ccgctatgggtggtattcgagaatgctgacgtgaacgccagcgatgtgcacatcattttc
aaaaacggtgacgatctccgccaggacatgttgacgctgcagatgctgcgtgtgatggac
cagctgtggaaacgcgatggtatggacttccgcatgaacatctacaactgcatcagcatg
gagaagagcctgggcatgatcgaggtggtgcgccacgcagaaaccattgccaacatacag
aaggaaaagggcatgttctcggccacgtcgccattcaagaagggctcgctactcagttgg
ctcaaggagcacaacaagcccgccgacaaactgaacaaagccatcaatgagttcacgctc
agctgtgcaggctactgcgttgccacctatgtgcttggcgtagctgatcgacactcggac
aatataatggtcaagcgaaatggacagctttttcacatcgatttcggccacattctgggc
cacttcaaggaaaagcttggagtacgtcgggaacgagtgccctttgtgttgacccacgat
tttgtttacgtgatcaacaagggcttcaatgaccgcgagtctaaagagttttgtcacttt
caggaattgtgcgagcgcgcctttctagttttacgcaaacacggctgccttattctatcg
ctgttctcaatgatgatttcaacgggactgccagaactgtcctccgaaaaggatttggac
tacctacgggaaactttagtgctggactacacggaggaaaaagcacgcgaacatttccga
gcgaaattcagcgaagctttggccaactcctggaagacttcccttaactgggcctcgcac
aacttctccaagaacaacaaacagtaa

DBGET integrated database retrieval system