KEGG   Drosophila simulans: Dsim_GD20048Help
Entry
Dsim_GD20048      CDS       T01065                                 

Definition
GD20048 gene product from transcript GD20048-RA
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dsi  Drosophila simulans
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dsim_GD20048
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Dsim_GD20048
   04068 FoxO signaling pathway
    Dsim_GD20048
   04070 Phosphatidylinositol signaling system
    Dsim_GD20048
   04150 mTOR signaling pathway
    Dsim_GD20048
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dsim_GD20048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1079 aa AA seqDB search
MNMMDNRALAYVAHQPKYETPPEEAEPPCMRFSVNLWKNEMLNWVDLICLLVNPANTIQV
IKVEMVNQAKQMPLGYVIKEACEYQVYGISTFNIEPYTDETKRLSEVQPYFGILSLGERT
DTTSFSSDYELTKMVNGMIGTTFDHNRTHGSPEIDDFRLYMTQTCDNIELERSVYTWQQR
LLYEHPLRLANSTKMPELIRERHPTRTFLIVVKNENDQSTFTLSVNEQDTPFSLTESTLQ
KMNRSQMKMNDRTSDYILKVSGRDEYLLGDYPLIQFLYIQEMLSDSAVPNVVLQSVYRLE
SYINHHNEQAMVTKRLPPKKQTVHPQKAISSLWDMGNYFQLTLHSISNVNFDKTRALKVG
VHVCLYHGDKKLCAQRSTDSPNGNFDTFLFNDLVMDFDIQMRNLPRMTRLCIVIFEVTKM
SRSKKSSNNKDIALKDVPYNKNPLAWVNTTIFDHKDILRTGRHTLYTWTYADDIQSVEVF
HPLGTIEPNPRKEECALVDLTFHSSGTGTVRYPSEDVVLQYAAEREQANRLQRQLAGPEK
PIKELKDLVANYTGLDKIYEMVDQDRNAIWERRNDILREIPEELSILLHCVYWKERDDVA
DMWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLHFLKDEDLLLYLLQLVQAIKHE
SYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPSMQTRFGLLLEVYLKGCKHHVAPL
RKQLHVLEKLKQGSLIAKKGSKEKVKTMLQDFLRDQRNSGVFQNIQNPLNPSFRCSGVTP
DRCKVMDSKMRPLWVVFENADVNASDVHIIFKNGDDLRQDMLTLQMLRVMDQLWKRDGMD
FRMNIYNCISMEKSLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSWLKEHNKPAD
KLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILGHFKEKLGVR
RERVPFVLTHDFVYVINKGFNDRESKEFCHFQELCERAFLVLRKHGCLILSLFSMMISTG
LPELSSEKDLDYLRETLVLDYTEEKAREHFRAKFSEALANSWKTSLNWASHNFSKNNKQ
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgatggacaacagggcgttggcctacgtggcccaccagcccaagtatgagaca
ccaccggaagaggcggagccgccatgcatgcgcttttcggttaacctgtggaagaacgag
atgctgaactgggtagacttgatctgcctgttggtcaatccggcgaacaccatccaggtc
atcaaggtggagatggtcaaccaggccaaacagatgccactgggctatgtgatcaaagag
gcctgcgagtaccaggtgtacggcatctcgaccttcaacatcgaaccgtacaccgacgaa
acgaagcgactcagtgaggtgcagccgtacttcggaatcctcagcctgggcgagcgcacc
gacacaacgagctttagcagcgactacgagctgaccaagatggtcaacggaatgatcggc
accaccttcgaccataatcgaacgcacggctcgcccgagattgacgacttccggctgtac
atgacccaaacttgcgacaacatcgaactggagcgctccgtctacacctggcagcagaga
ctactctacgagcatccgctgcggctggcgaactcgactaagatgcccgagctgatacgg
gagcggcatccgaccagaacctttctcatcgtcgtgaaaaacgagaacgaccagagtacg
tttacgttgtcggtgaacgagcaggacactcccttctcgctcacggaaagcacgctgcag
aagatgaatcggtcgcagatgaaaatgaacgaccggacctccgactacatactcaaggtg
agcggtcgcgacgagtacctgcttggggactatccgctgatccagttcctgtacatccaa
gagatgctctcggactcggcggttccgaatgtggtactgcaatcagtgtaccgccttgag
tcctatatcaaccaccacaacgagcaggccatggtaaccaagcgtttgccgccgaaaaaa
cagacagtccacccccaaaaggcaatctcttcgctgtgggacatgggcaactactttcag
ctgacgctacacagcatctccaatgtaaactttgacaagacgcgcgccctcaaggtgggc
gtgcatgtgtgcctatatcacggcgacaagaagttatgcgcccagcgatcaacggactcc
cctaatggcaactttgacacgttcctgtttaatgacctggtgatggactttgacatacag
atgcgcaacctaccgcggatgacacgactctgcattgtgatcttcgaggtgaccaaaatg
tcgcgctcgaagaagtcgtccaacaataaggacatcgctctgaaagacgtcccctacaac
aaaaacccgctggcttgggtcaacacaacaattttcgaccacaaggatatcctgcgcacc
ggtcgacatacgctgtacacgtggacgtatgctgacgacattcagtcggttgaggttttc
catccgctgggcaccatcgagcccaatccgcgcaaagaggaatgtgcgctggtggacctc
acattccacagcagcggaaccggaaccgtgcggtatcccagcgaggatgtcgtattgcag
tacgctgcggagcgggagcaggccaatcgactgcaacggcaactggcagggccagaaaag
ccgatcaaagaactgaaggatctggtggccaattatacgggactggataagatctacgaa
atggttgaccaggaccgcaatgccatttgggaacggagaaacgacattttgcgcgagatt
ccggaagagctgtccatcttactacactgcgtctattggaaggagcgtgatgacgtagcg
gatatgtggtatcttctcaaacagtggccgcttatttctatagaacgctccttggagcta
ctggactacgcatatccagatccggcagtaagacgctttgccatccggtgcttacacttt
ctgaaagacgaagacttgctcctgtatctgctgcaattggtacaggccatcaagcacgaa
tcgtacctggaaagcgatctggtagtgtttctgctggagcgagcactgcgcaaccagcgc
atcggccactacttcttctggcacctacgctctgagatgcagacgccgtctatgcaaaca
cgctttggcctactgctggaagtatacctcaagggttgcaaacatcacgtggcgccgctg
cggaagcagcttcatgtgctagagaagctgaaacagggatctctgattgccaagaagggt
agcaaggaaaaggtgaagaccatgctgcaggactttctgcgggaccagcgcaactcgggg
gtctttcagaacatccaaaatccacttaatcccagcttccggtgcagcggtgtaaccccc
gataggtgcaaggtaatggatagcaagatgcgaccgctatgggtggtattcgagaatgct
gacgtgaacgccagcgatgtgcacatcattttcaaaaacggtgacgatctccgccaggac
atgttgacgctgcagatgctgcgtgtgatggaccagctgtggaaacgcgatggtatggac
ttccgcatgaacatctacaactgcatcagcatggagaagagcctgggcatgatcgaggtg
gtgcgccacgcagaaaccattgccaacatacagaaggaaaagggcatgttctcggccacg
tcgccattcaagaagggctcgctactcagttggctcaaggagcacaacaagcccgccgac
aaactgaacaaagccatcaatgagttcacgctcagctgtgcaggctactgcgttgccacc
tatgtgcttggcgtagctgatcgacactcggacaatataatggtcaagcgaaatggacag
ctttttcacatcgatttcggccacattctgggccacttcaaggaaaagcttggagtacgt
cgggaacgagtgccctttgtgttgacccacgattttgtttacgtgatcaacaagggcttc
aatgaccgcgagtctaaagagttttgtcactttcaggaattgtgcgagcgcgcctttcta
gttttacgcaaacacggctgccttattctatcgctgttctcaatgatgatttcaacggga
ctgccagaactgtcctccgaaaaggatttggactacctacgggaaactttagtgctggac
tacacggaggaaaaagcacgcgaacatttccgagcgaaattcagcgaagctttggccaac
tcctggaagacttcccttaactgggcctcgcacaacttctccaagaacaacaaacagtaa

DBGET integrated database retrieval system