KEGG   Drosophila simulans: Dsim_GD20251Help
Entry
Dsim_GD20251      CDS       T01065                                 

Definition
GD20251 gene product from transcript GD20251-RA
Orthology
K04437  
filamin
Organism
dsi  Drosophila simulans
Brite
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsim_GD20251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 2380 aa AA seqDB search
MEAERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKR
MPKYNKRPTFRSQKLENVSVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYS
ISMPMWDGEDDKQLNGSGHTPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAP
GLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNS
KLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEI
EKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVT
GPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYV
TALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYT
EGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPF
EVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGD
GSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTI
KQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTATSGVPHTVEVNY
GGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIH
EETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIK
VDGLEPTDLAVTITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPF
RLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDN
GDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIM
NAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHT
IELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSL
AIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSK
VKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAV
HYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLPAEFE
IDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEG
SPFKLEAFPTGEAKKCKLVEQAPKIQSSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVD
IDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTT
KVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGT
VSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFT
ISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSP
YFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGN
IGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADN
IFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVE
GSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNV
TEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAG
GSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGE
YRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGEL
DAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDV
ADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVR
YTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNT
GVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHV
KHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV
NT seq 7143 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgaacgcgatctcgccgaggatgcacagtggaagaagatccaacagaacacc
ttcacccggtgggccaacgagcacctgaagaccatcgatcggtcgatcaacaacctggag
acggacctgtccgacggcctccgactgatcgccctgatcgaggtgctgtcccagaagcga
atgcccaaatacaacaaacgcccaacattccgcagccagaaactggaaaacgtctcggtg
gccctgaaattccttcaggatgagggtatcaaaatcgttaacattgactcgtcggacatt
gtggactgtaagctgaaactgatactgggtctgatatggacactgattctgcactactcg
atatcgatgcccatgtgggatggcgaggacgacaagcagctcaacggctcgggccatacg
cccaagcagcgcctgctgaactggatacacgccaagatacccgacttgcccatcaacaac
tttaccaacgactggaccacgggcaaggcggtgggcgcccttgttgacgcctgtgctccg
ggtctctgtcccgattgggagctgtgggatcccaaggatgccgtgcagaatgcctccgag
gccatgggcctggccgatgactggctcaacgtgcgccagctgatcaagcccgaggagctg
gtcaaccccaacgtggatgagcagtctatgatgacgtatctgtctcagtaccccaactcc
aagctcaagactggagctcccttgaggccgaaaacgaatcccaacagagtgcgtgcctat
ggtcctggtattgagcctattggtcctgtggtgggtgccccagccaatttcaccgtcgaa
accttctctgctggcaagggttctgtggatgttgacatccagggacccaatggagagatc
gagaaggctgatgtgcgcttcaacaatgacaagaacctcacgtatacagtttcgtacata
cccaaatccgagggttcgcacaaagtggccgttaagttctccggtcgcgacattcccaag
tcgccgttccccgtcaaggtggaaggtcatgctggtgacgcctctaaggtgaaggttacc
gggcccggaatacagccaaacggtgttaccatcaagaagccaaccttcttcgatattctt
gccaaggatgccggtcgcggagtgcccgaagtcattatcatcgatccggctaaccacaag
acttctgtggccgccaaagtgcgtcagctggaaaacgatacttggcgatgcgagtacgtg
accgctctacagggattgcattcggtgaatgtcttctatgctggcacaccgatccccaac
agtccgttccctgtgaaggtagctccgctgtccgatgcgcgtaaggttcgcgcttctgga
cgcggtctccaggcaacaggcgttcgcgtcggtgacgatgccgacttcaagatctatacc
gagggagccggcgagggtgagccagaggtgcgcgtcattggtcctggaggcatgaaccag
aacgtcatgcaatcgaaggtggatggcaatacctacgagtgccactactatcccaccaag
gaaggccgctacgtcatcatggtgacctttgctggccaagaagttgccaagtctccgttt
gaggtgaaggtgggtcccaagaaggagtcctcgattgtggcctatgggcccggactgagc
agcggcgttattggctacccggctgcttttgtagtggagaccaatggcgagactggcgcc
ctcgggttcaccgtggccggtccctcgcaggccgagatcgagtgccacgacaacggcgat
ggttctgccctggtcaagtatcatcccaccgctgtgggagagtacgccgtgcatatattg
tgtgacaatgaggacatccccaagtcgccgtttatcgctcagatccttccacgcaccgat
ttccatcccgagctggtcaaggctagtggtcctggactggagaagaacggcgtgaccatt
aaacagccgaccagcttcaccgtggaccccagcaaggcaggcaatgctccgttggacgtt
gtcgttcaggatgtcttcggcaccaagttgcccgtggagctgaagaacaacccagatggc
accaagaaggtcacctatacggctacttctggagttccgcacaccgtcgaagtaaactat
ggcggagtttctacacccaattcaccccatcgtgtttatgtcggagttccggtcgatgca
gccaaggtgcaggcctttggaccctggttgcagcctggagtgcgccccaacgcagctaca
cacttcaatgtggacgcccgtgaagctggagacgccgagctgaaggtaaagatcattcat
gaggaaactaagatcgaggtaccgtgccgcatcatcgataacgaggacaacacctactcc
gtggaagtgattccgccttccaaaggtgcctacaccactacaatgacgtacggtggccaa
agggttcccctgggagagaaggtcgtcgtggaacaaacggtggatgtatccaagatcaag
gtggacggtcttgagccaacggacttggcggtaaccatcaccagtccatcgggcaatcgc
ataaaagcccacatcataccgaccgcagagggatttctggttaactttaccccaacccaa
ctgggcgagtatctgttaagcatctgctttgggggcaccccgatcactccacgtccattc
cggctgcagtgcctcacgggcagtgattcgaataaggtgcaagcctttggaccaggccta
gaacgtggcatcgttggccagccggccgaatttatgattgatacgcgtggcgccggacag
ggcggattgggagtgacggtggaaggtccctgcgaggcggccatcaattgccgcgataat
ggagatggtacttgcaacgtcgcctatttaccgactgaggcgggcgattataccgtcaac
ataacgttcaacgagcggcacataaccggctcgcccttccagccactaatagttccggtt
ccgaatctgaagaatacccgcgtcagcggcatcggcatccagccgcatggtgtgatcatg
aatgcggccacggacttcatggttgatatgagcaaggtgggcagcaacatcgactcagga
aagctgtcctgtgcgatcttcgacccaatgggtcatgtgttgccaagcaagattgtgcaa
ggtccaaccgacgacatcttccgcatcatgtacactccattcgaggctggccgacacacc
attgagctgatgtacgacaacatcccagtgccaggatctccgtttgttgtaaatgtgaag
agcggctgcgatcccgctcgctgcaaggcctacggacctggcctcgaaaaaggactgacc
aaccagaaaaacaaattcaccgtggagaccaagggtgcaggaaatggtggcctttcgctt
gccatcgagggtccttcggaggcgaaaatgacgtgcacggacaatcgtgacggtagctgt
gacgtggactatttggccactgatccaggagagtatgacattaccattcggtttgcggac
aagcacatacccggctctccgttccgcgtgctcgtcgaggagactgtggatcccagcaag
gtgaaggtgtacggtccgggcatcgagcacggccaggtgcgcgagagtgtgcccaccttc
ttcaacgtggatgtgggcgaggctggtcctggccgcattgcagttaagttgaccaactcc
gagggtattcccgtggacaatctacgcgtggaagacaagggcaattgcatttacgcggtt
cactatgtgccgcccaaggctggctccgtgctcacctgccaggtgaaattctccgaggtt
gaagtgccatgcagtccatttgtgatgaccgttttccctaaatcagaacccaccaaggtt
aaggtaaagggtgtcaatgagaagaagaaaacgcctgcttcccttcccgccgagtttgaa
atcgatacaaagcaagccggccaggctgatataaatgtggccattaagaaccccaagggc
aaggcgatgcagccgcgcctggaggaggtgtccaccggcacgtacgtggtgtcatttgtg
ccagatgagtgcggcacctaccagtgcagcatcaagtacggcgacaaggagatcgagggc
tcgcccttcaaactcgaagcattccccaccggcgaagccaagaagtgcaaactggtggag
caggcgcccaagattcagtcctcgggcagtcaatcgcacctgaaagtggatgcccgcgag
gccggagatggagcggtgacctgcaagatcaccaacaaggcgggcagcgaaattgtggac
attgatgtgatcgaaaaggatggtttcttcgacattctgtacgcccttaacgatcccgga
gattatgacatcaacgtaaagttcggcggcaaggacatcccgaacggcagcttctccatc
aaggctgtcgaaagtatcgagcaatactcgcattctgaatacatcgaggagcacacgacc
aaagtggtgcagcaaactacgcagagcgagcttgtcaacggaaaatctgagatcacctat
cgcagtgtagcatttgagaaattaccactacccacaacaggcggcaacgttacagctgaa
gtcagaatgcctagcggtaaagtagacaaacccgtgatccaggacaaccgtgatggtacc
gtctcggtgaagtacgatccccgtgaggagggatcccacgagctggtggtcaaatacaac
ggagaacccgtgcaaggatctcccttcaaattccacgttgactcgatcacctccggctat
gtgactgcctatggacccggtctgacccacggagtcaccggtgagccggccaactttacc
atctccaccaagggagccagcgccggtggcctgaccatggccgtcgaaggacccagcaag
gctgacatcaactaccatgacaacaaagacggcactgtctccgtgcaatacctgcccact
gctcctggcgagtaccaggtgtccgttcgcttcggcgataagcacatcaagggatcgccg
tacttcgccaagatcaccggcgagggtcgcaagcgcaaccagatctcggttggctcctgc
tccgaagttaccatgcccggcgacattaccgatgacgatctgcgcgctttgaacgcctcg
atccaggcgcccagtggtctggaggagccctgcttcttgaagcgcatgcccactggcaac
attggcatctcgttcactccccgcgagattggcgagcacctggtgtcggtgaagcgtctg
ggcaagcacatcaacaactcaccatttaaggtgactgtctgcgagcgcgaggtgggcgac
gccaagaaggtcaaggttagcggaactggcctcaaggagggtcaaacccatgccgacaac
atcttctccgtggacacgaggaacgccggcttcggtggtctttcggtctccattgagggt
cccagcaaggctgagatccagtgcacggataaggatgacggtactctcaacatctcgtac
aagcccacggagccgggctactacattgttaacctgaagttcgccgatcaccacgtggag
ggttctcctttcaccgtcaaggttgccggcgagggcagcaaccgcaagcgcgagaagatc
cagcgggagcgcgatgctgttccaatcacggaaatcggaagccagtgcaagctgacattc
aagatgcccggcattacctcgttcgatctggccgcctgcgtcacctcgcctagcaatgtg
accgaggatgcggagatccaggaggtggaggatggcctctacgcagtgcactttgtgccc
aaggaattgggcgtgcacacggtgtcggtgcgctattccgagatgcacatacccggatca
ccgttccagttcaccgtgggaccactgcgcgactccggcagccatcttgttaaggctgga
ggctctggtctggagcgaggtgttgtcggagaagcggccgagttcaatgtgtggacccgc
gaggcaggcggtggttccctggccatttccgtggagggtcctagcaaggctgacatcgag
tttaaggaccgcaaggacggcagctgcgatgtgtcctacaaggtcaccgaaccgggagag
taccgcgtgggcctgaaattcaacgatcgccacatacccgactcaccattcaaggtgtac
gtgtctccagatgcgggtgatgcccacaagctggaggttcagcagttcccgcaaggtaac
atccaggcggatgctccctaccaattcatggtccgcaagaacggtgccaagggtgagctg
gatgccaagattgtggctccatccggaacggacgatgattgcttcatccaggtgatcgac
ggcgagatgtactcggtgcgcttctatccacgcgagaacggaatccatgccatccatgtc
aagttcaacggcgtccacatacccgactctccattcaggatcaaggtgggcaaggatgtg
gccgatccggctgctgtgcacgccagcggcaatggattggacgaagtgaagactggacac
aaggccgacttcatcatcaatacctgcaacgccggcgttggcacgttggccgtctccatc
gatgggccctccaaggtggccatggactgcacagaggttgaagagggctacaaggtccgc
tacaccccgctcctgcctggcgagcactacatcacggtcaagtacaacaacatgcacatc
gtgggctcgccattcaaggtgaacgctaccggcgacaagttggcggatgagggcgcccag
gagacgtccacggtgatcgtggagacagtgcagaaggtggccaagggaggcaagaacacg
ggcgttcatctgcccaccttcaagtcggatgccagcaaggtggtgtccaagggtatgggc
ctgaagaaggcctacattggcaagcagaaccagttcagcatcagcgccaccgatgcgggc
aacaacatcctgtacgtgggcatgtacggaccaaagggaccctgcgaggagttccacgtg
aagcacgctggccacaacaactataatgtgcagtatctggtgcgcgaccgcggccagtac
gtgctcctaatcaagtggggcgaggagcatatacccggctccccattccagatcgatgtg
tag

DBGET integrated database retrieval system