KEGG   Drosophila simulans: Dsimw501_GD20251Help
Entry
Dsimw501_GD20251  CDS       T01065                                 

Gene name
Dsim_GD20251
Definition
(RefSeq) GD20251 gene product from transcript GD20251-RE
  KO
K04437  
filamin
Organism
dsi  Drosophila simulans
Brite
Cytoskeleton proteins [BR:dsi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Dsimw501_GD20251 (Dsim_GD20251)
  Intermediate filaments
   Intermediate filament-binding proteins
    Dsimw501_GD20251 (Dsim_GD20251)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsimw501_GD20251 (Dsim_GD20251)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
3R
AA seq 919 aa AA seqDB search
MHFSWLSEKAPTPPATWADHSYFFRPQYYKVTVSERDHPERTHVYFNETIIPENQGLNGS
DFMPLNFKSSFSIVTHQAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNG
EPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKA
DINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCS
EVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLG
KHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGP
SKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQ
RERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPK
ELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTRE
AGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYV
SPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDG
EMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHK
ADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIV
GSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGL
KKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYV
LLIKWGEEHIPGSPFQIDV
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcagttggctgtcagagaaagcgcccacgccgccagccacctgggccgatcac
tcgtacttcttccggccgcagtactataaggtgaccgtatccgagcgcgatcacccggaa
cggacgcacgtgtacttcaatgagacgatcataccggagaaccaaggactaaatggttca
gactttatgccattgaatttcaaatcatcgttttcaattgtaacacatcaagctgaagtc
agaatgcctagcggtaaagtagacaaacccgtgatccaggacaaccgtgatggtaccgtc
tcggtgaagtacgatccccgtgaggagggatcccacgagctggtggtcaaatacaacgga
gaacccgtgcaaggatctcccttcaaattccacgttgactcgatcacctccggctatgtg
actgcctatggacccggtctgacccacggagtcaccggtgagccggccaactttaccatc
tccaccaagggagccagcgccggtggcctgaccatggccgtcgaaggacccagcaaggct
gacatcaactaccatgacaacaaagacggcactgtctccgtgcaatacctgcccactgct
cctggcgagtaccaggtgtccgttcgcttcggcgataagcacatcaagggatcgccgtac
ttcgccaagatcaccggcgagggtcgcaagcgcaaccagatctcggttggctcctgctcc
gaagttaccatgcccggcgacattaccgatgacgatctgcgcgctttgaacgcctcgatc
caggcgcccagtggtctggaggagccctgcttcttgaagcgcatgcccactggcaacatt
ggcatctcgttcactccccgcgagattggcgagcacctggtgtcggtgaagcgtctgggc
aagcacatcaacaactcaccatttaaggtgactgtctgcgagcgcgaggtgggcgacgcc
aagaaggtcaaggttagcggaactggcctcaaggagggtcaaacccatgccgacaacatc
ttctccgtggacacgaggaacgccggcttcggtggtctttcggtctccattgagggtccc
agcaaggctgagatccagtgcacggataaggatgacggtactctcaacatctcgtacaag
cccacggagccgggctactacattgttaacctgaagttcgccgatcaccacgtggagggt
tctcctttcaccgtcaaggttgccggcgagggcagcaaccgcaagcgcgagaagatccag
cgggagcgcgatgctgttccaatcacggaaatcggaagccagtgcaagctgacattcaag
atgcccggcattacctcgttcgatctggccgcctgcgtcacctcgcctagcaatgtgacc
gaggatgcggagatccaggaggtggaggatggcctctacgcagtgcactttgtgcccaag
gaattgggcgtgcacacggtgtcggtgcgctattccgagatgcacatacccggatcaccg
ttccagttcaccgtgggaccactgcgcgactccggcagccatcttgttaaggctggaggc
tctggtctggagcgaggtgttgtcggagaagcggccgagttcaatgtgtggacccgcgag
gcaggcggtggttccctggccatttccgtggagggtcctagcaaggctgacatcgagttt
aaggaccgcaaggacggcagctgcgatgtgtcctacaaggtcaccgaaccgggagagtac
cgcgtgggcctgaaattcaacgatcgccacatacccgactcaccattcaaggtgtacgtg
tctccagatgcgggtgatgcccacaagctggaggttcagcagttcccgcaaggtaacatc
caggcggatgctccctaccaattcatggtccgcaagaacggtgccaagggtgagctggat
gccaagattgtggctccatccggaacggacgatgattgcttcatccaggtgatcgacggc
gagatgtactcggtgcgcttctatccacgcgagaacggaatccatgccatccatgtcaag
ttcaacggcgtccacatacccgactctccattcaggatcaaggtgggcaaggatgtggcc
gatccggctgctgtgcacgccagcggcaatggattggacgaagtgaagactggacacaag
gccgacttcatcatcaatacctgcaacgccggcgttggcacgttggccgtctccatcgat
gggccctccaaggtggccatggactgcacagaggttgaagagggctacaaggtccgctac
accccgctcctgcctggcgagcactacatcacggtcaagtacaacaacatgcacatcgtg
ggctcgccattcaaggtgaacgctaccggcgacaagttggcggatgagggcgcccaggag
acgtccacggtgatcgtggagacagtgcagaaggtggccaagggaggcaagaacacgggc
gttcatctgcccaccttcaagtcggatgccagcaaggtggtgtccaagggtatgggcctg
aagaaggcctacattggcaagcagaaccagttcagcatcagcgccaccgatgcgggcaac
aacatcctgtacgtgggcatgtacggaccaaagggaccctgcgaggagttccacgtgaag
cacgctggccacaacaactataatgtgcagtatctggtgcgcgaccgcggccagtacgtg
ctcctaatcaagtggggcgaggagcatatacccggctccccattccagatcgatgtgtag

DBGET integrated database retrieval system