KEGG   Drosophila simulans: Dsim_GD20381Help
Entry
Dsim_GD20381      CDS       T01065                                 

Definition
GD20381 gene product from transcript GD20381-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dsi  Drosophila simulans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dsim_GD20381
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dsim_GD20381
Glycosyltransferases [BR:dsi01003]
 Polysaccharide
  Storage polysaccharide
   Dsim_GD20381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 709 aa AA seqDB search
MRRQQSYRFEDNESTSYALRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVAN
KVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSR
GYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFM
IAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLL
GRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHL
LKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIA
GRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQL
RDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVA
DDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYY
EPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSS
FMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGS
KNNLIFSRPHSEPPSPTSSRHTTPAPSVHGSDDEDSVDEETELKELGIK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacagcagtcctaccgtttcgaggacaacgagtccacctcttacgccctgagg
atgaatcgtcgcttttcaagagtggagtccggggcggaccttaaggattatttcgatcgg
ggtgatatcgcttcccgggagaaccgctggaacttcgaggtggcatgggaggtggccaac
aaggtgggcggtatttacacggtgatccggtcgaaggcatatgtctccaccgaggagatg
ggcgagcagttgtgtatgatgggtccctacaaggagcactgtgcccgcaccgagatggaa
gagatggagttccccaggggaaaccccttactagacgctgtcaactcattgcgctcgcga
ggctataaaatccacaccggtcgctggctggtggacggaaatccccaattaatccttttc
gatattggatcagccgcctggaagctggatcagttcaaatcggagatgtgggagaagtgc
catattggaatacctcatttggatatcgagacgaacgatgccattatccttggctttatg
attgccgagttcctggaggagttccgcaactttgccgtgacttattcgcaaaacaacgaa
ctgagcgctccgaggattgtcgcccacttccacgaatggcaagctggcgtgggtctcatt
gtcctacgtactcgtctggtggagatcgccactgtgttcactacccacgccacattgttg
ggtcgttacttgtgcgccggcaacaccgatttctacaacaatctggacaagttcgccgtg
gacgaggaggcgggcaagcgccaaatctaccatcgctattgcctggagcgaggtgccact
cacttggctcatgtgttcaccaccgtctccgagattacgggctacgaggcagagcatctg
ctcaagcgcaaaccggacatcatcacgcccaatggactgaacgtgaagaagttctcggcc
atccacgagttccagaacttgcacgccgttgccaaggagaagatcaacgaattcgtgcgg
ggtcacttttacggccacattgactttgatttagataagaccctgtacttcttcatcgcc
ggtcgctacgagtttggcaacaagggagccgacatcttcatcgaggcactggcccgcttg
aacgcgatgctcaagcacgagaagccggacaccacggtggtggcctttctcatcttcccc
accaagaccaacaacttcaacgtggactcgctgcgaggacatgccgtgatcaagcagttg
cgcgatacgatcaacaacgtccagcaggccgtgggcaagcggatgttcgacacttgcctg
cagggcaacatacccaatgccgatgatctgcttcagaaggatgacctggtcaagatcaag
cgttgcatgttcgccatgcagcgcgattcgatgccgcctgttaccacgcacaatgtggct
gatgactggaatgatccggtgctatcctcaatccgtcgttgccatctgttcaactcgcgc
cacgatcgtgtcaagatggtcttccatccggagttcctcacatccacaaatcctctgttt
ggaatcgactacgaggaatttgtccgtggctgccacttgggtgtcttcccctcatactac
gagccctggggttacactcccgccgaatgtacggtgatgggtatccccagcgtaaccacc
aatctgtctggctttggctgcttcatggaggagcacatcagtgatcccaagtcctacggt
atctacatcgtggatcgccgctatatcggcttggagaacagcgttcagcagctgtccagc
tttatgatggagttctccaggctgaaccgccgccagcgcattatccagcgtaatcgcacg
gagcggttgagcgatcttctggactggcgcaccctgggcatttactacagacaggccagg
gttaaggccctgcaagctgtttacccagactatgtggatgaattgtctctttatgggtcg
aagaacaacttgatcttctcgcgaccgcacagcgaacctcccagtcctacttcatcgcgg
cacaccactccagctccatcggttcacggttcggatgacgaggactccgtggatgaggag
accgaactcaaggaattggggattaagtag

DBGET integrated database retrieval system